BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30283.Seq (776 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X99665-1|CAA67979.1| 106|Drosophila melanogaster mitochondrial ... 57 2e-08 BT001763-1|AAN71518.1| 106|Drosophila melanogaster RH08870p pro... 57 2e-08 AE014297-3317|AAF56127.1| 106|Drosophila melanogaster CG4412-PA... 57 2e-08 BT023609-1|AAY85009.1| 159|Drosophila melanogaster IP06415p pro... 42 0.001 AE014296-920|AAF47954.1| 147|Drosophila melanogaster CG12027-PA... 42 0.001 >X99665-1|CAA67979.1| 106|Drosophila melanogaster mitochondrial ATPase couplingfactor 6 subunit protein. Length = 106 Score = 57.2 bits (132), Expect = 2e-08 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 407 SKLVGLRAATTSMMVSRNLAAA--QKATDPIQQLFLDKIREYKQKSAGGKVPD 255 S L G+R T + + A KA+DPIQQLFLDK+REYKQKSAGGK+ D Sbjct: 5 SLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGKLVD 57 >BT001763-1|AAN71518.1| 106|Drosophila melanogaster RH08870p protein. Length = 106 Score = 57.2 bits (132), Expect = 2e-08 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 407 SKLVGLRAATTSMMVSRNLAAA--QKATDPIQQLFLDKIREYKQKSAGGKVPD 255 S L G+R T + + A KA+DPIQQLFLDK+REYKQKSAGGK+ D Sbjct: 5 SLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGKLVD 57 >AE014297-3317|AAF56127.1| 106|Drosophila melanogaster CG4412-PA protein. Length = 106 Score = 57.2 bits (132), Expect = 2e-08 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 407 SKLVGLRAATTSMMVSRNLAAA--QKATDPIQQLFLDKIREYKQKSAGGKVPD 255 S L G+R T + + A KA+DPIQQLFLDK+REYKQKSAGGK+ D Sbjct: 5 SLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGKLVD 57 >BT023609-1|AAY85009.1| 159|Drosophila melanogaster IP06415p protein. Length = 159 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/43 (46%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = -1 Query: 374 SMMVSRNLA--AAQKATDPIQQLFLDKIREYKQKSAGGKVPDP 252 S+++ R+++ A+ + DPI Q+FLDK+REY+ KS GK DP Sbjct: 21 SLVLCRSVSNTASLRYKDPIYQIFLDKVREYRLKSPKGKPVDP 63 Score = 37.9 bits (84), Expect = 0.015 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 201 QYGGGPGIDMTAFPSLKFEEPKLDPIDEQAAPK 103 QYGGG G+DM FP K + +DPI P+ Sbjct: 81 QYGGGEGVDMLEFPKFKLPDIDIDPISVDDLPE 113 >AE014296-920|AAF47954.1| 147|Drosophila melanogaster CG12027-PA protein. Length = 147 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/43 (46%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = -1 Query: 374 SMMVSRNLA--AAQKATDPIQQLFLDKIREYKQKSAGGKVPDP 252 S+++ R+++ A+ + DPI Q+FLDK+REY+ KS GK DP Sbjct: 9 SLVLCRSVSNTASLRYKDPIYQIFLDKVREYRLKSPKGKPVDP 51 Score = 37.9 bits (84), Expect = 0.015 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 201 QYGGGPGIDMTAFPSLKFEEPKLDPIDEQAAPK 103 QYGGG G+DM FP K + +DPI P+ Sbjct: 69 QYGGGEGVDMLEFPKFKLPDIDIDPISVDDLPE 101 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,784,827 Number of Sequences: 53049 Number of extensions: 550743 Number of successful extensions: 722 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -