BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30282.Seq (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces po... 30 0.37 SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomy... 26 6.0 >SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 29.9 bits (64), Expect = 0.37 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 530 DVVDPRPTKGVHKEMRVKKEALYHLSAFFSVAFSR 634 DV DP+ VH + + +EAL S FFS F R Sbjct: 1020 DVNDPKVETVVHPVLTLTREALLRQSEFFSPIFKR 1054 >SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1583 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +2 Query: 479 VKVADEAVKESTQRRIRDVVDPRPTKGVHKEMRVKKEALYHLSAFFSVAF 628 +K+ D + ++ Q+ P P K + + +LYH S F ++ F Sbjct: 726 LKIIDNCIDKNMQKSQEGFQGPSPFKADENDEDIFIISLYHSSLFLNLKF 775 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,254,533 Number of Sequences: 5004 Number of extensions: 35117 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -