BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30279.Seq (635 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 1.5 CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein ... 23 6.1 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 6.1 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 23 6.1 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 6.1 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -2 Query: 325 YLHSLTCWSQDCHQ 284 YLH L W CHQ Sbjct: 549 YLHGLVSWGYGCHQ 562 >CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein protein. Length = 207 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 408 LVKTARFKELAPYDPDWFYV 349 +V RF+++A PDW +V Sbjct: 161 VVSNDRFRDVASEHPDWAFV 180 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.4 bits (48), Expect = 6.1 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 6/66 (9%) Frame = -1 Query: 371 MTLIGSMCVVLPSFVIFTFA--HLLESRLSPRSSVGA----NVMEYTFTFLQVIRQYCTQ 210 +T+IG +C L +F L+E S + + + E TF+Q++ Q C + Sbjct: 384 LTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQK 443 Query: 209 GFAIVG 192 I G Sbjct: 444 AMTISG 449 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 23.4 bits (48), Expect = 6.1 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 6/66 (9%) Frame = -1 Query: 371 MTLIGSMCVVLPSFVIFTFA--HLLESRLSPRSSVGA----NVMEYTFTFLQVIRQYCTQ 210 +T+IG +C L +F L+E S + + + E TF+Q++ Q C + Sbjct: 237 LTVIGYLCYALAQVFLFCIFGNRLIEESSSVMKAAYSCHWYDGSEEAKTFVQIVCQQCQK 296 Query: 209 GFAIVG 192 I G Sbjct: 297 AMTISG 302 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.4 bits (48), Expect = 6.1 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 6/66 (9%) Frame = -1 Query: 371 MTLIGSMCVVLPSFVIFTFA--HLLESRLSPRSSVGA----NVMEYTFTFLQVIRQYCTQ 210 +T+IG +C L +F L+E S + + + E TF+Q++ Q C + Sbjct: 384 LTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQK 443 Query: 209 GFAIVG 192 I G Sbjct: 444 AMTISG 449 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,630 Number of Sequences: 2352 Number of extensions: 9829 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -