BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30271.Seq (443 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 6.4 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 22 8.5 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 6.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 293 FDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMICM 183 F + + LD C+ + G DT+ V F VL +IC+ Sbjct: 610 FKNQEPLDTCKEFMFEGQ----DTLQVIFIVLGLICI 642 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 22.2 bits (45), Expect = 8.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 260 GWFVPGLPWLFDTI 219 G+ + +PWLF+T+ Sbjct: 215 GFRIDAVPWLFETV 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 359,838 Number of Sequences: 2352 Number of extensions: 6233 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -