BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30261.Seq (510 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|ch... 29 0.31 SPBC337.16 |cho1||phosphatidyl-N-methylethanolamine N-methyltran... 25 5.0 SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyce... 25 6.6 >SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 29.5 bits (63), Expect = 0.31 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +1 Query: 244 SRAGSGTLPPALFCLYSLILSKNSCWM---GSVAF*AAAKFLLTIMEVVAALKPTS 402 SRAG G LP F + +LSKN W+ V +LL V A LKP S Sbjct: 298 SRAGMGPLPKDAFIKFVQLLSKNRNWVLMRDIVQLEEYNSYLLDHRIVSAFLKPLS 353 >SPBC337.16 |cho1||phosphatidyl-N-methylethanolamine N-methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 221 Score = 25.4 bits (53), Expect = 5.0 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 304 SKNSCWMGSVAF*AAAKFLLTIMEVVAALKPTSFDTSIFLIPIDQGISPRIFSFDS 471 SK +C+M + A I + +PT IF+ P+ QGI+ IF F S Sbjct: 70 SKKACYMLAACIFVAGIVRDLIYQNALKQQPT---LGIFMNPLVQGIAKLIFCFGS 122 >SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 25.0 bits (52), Expect = 6.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 370 MEVVAALKPTSFDTSIFLIPID 435 +E+ +AL P FD S +PI+ Sbjct: 138 LEIESALPPAMFDASFIFLPIN 159 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,851,100 Number of Sequences: 5004 Number of extensions: 34265 Number of successful extensions: 84 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -