BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30257.Seq (787 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 26 0.39 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 0.91 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 4.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.4 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.4 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.8 bits (54), Expect = 0.39 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 584 PISPY-SESYYNSLGRRFTTRDWEKPWGYPTLIRLCSKXPPFRQXG 718 P+ P S + +L +FTT+ KP P ++ + PPF G Sbjct: 160 PLPPTTSTTTRTTLTTKFTTKPSTKPTNKPVVVTKPPQAPPFATVG 205 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 24.6 bits (51), Expect = 0.91 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 170 RFLKFVLQQSGLNQVQWAPVYTQHSMTTLAIR 75 R++K VL +SG++ + T+H+ T+ A R Sbjct: 268 RWIKMVLAESGVDTSIYTAHSTRHAATSAAAR 299 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -3 Query: 254 VNLCYMTTTLDCHSDVNHREF 192 V +C+ + CH D+ R F Sbjct: 3 VAICFALMCIACHPDIQERIF 23 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 269 ISKALIAFYQKYVDEASKKEIKDI 340 I K +IAFY K + + EIK I Sbjct: 126 IVKPIIAFYYKPIKTLNGHEIKFI 149 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 50 SEYLDGLDGLTSCLLH 3 S Y+DG+ +T C +H Sbjct: 143 SPYMDGVPFVTQCPIH 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,794 Number of Sequences: 336 Number of extensions: 3893 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -