BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30254.Seq (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 52 4e-07 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) 27 9.1 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 51.6 bits (118), Expect = 4e-07 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = -2 Query: 470 MVRMNVLSXALKXXXXAXXRGXXQVLIXPCSKVIVKFLTVMMK 342 MVR+NVL+ AL A RG QV I P SKVIVKFLTVMMK Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMK 43 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 44.0 bits (99), Expect = 7e-05 Identities = 20/26 (76%), Positives = 23/26 (88%), Gaps = 1/26 (3%) Frame = -1 Query: 252 VISPRFDVPINDIERW-TNLLPSRQF 178 VISPRFDV + DIE+W +NLLPSRQF Sbjct: 3 VISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) Length = 549 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 249 ISPRFDVPINDIERWTNLLPSRQFGYL 169 ISP F VP D ++ ++L+PS+Q +L Sbjct: 381 ISPIFTVPKKDGKKKSSLIPSQQITFL 407 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,699,515 Number of Sequences: 59808 Number of extensions: 175439 Number of successful extensions: 277 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 275 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -