BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30252.Seq (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 27 0.13 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 2.7 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 27.5 bits (58), Expect = 0.13 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 414 Y*NTSYHLIYLTWHGTST--VCEWCWCGMEF 500 Y TS+ +L WH VC W +CG F Sbjct: 326 YGKTSHLKAHLRWHTGERPFVCNWLFCGKRF 356 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.0 bits (47), Expect = 2.7 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = -2 Query: 272 ESLNLKDSKT*RT*ILGYNLF*IIIHLFDTRVAISHVIFMILKY*IEYYRRESVQALTYW 93 E N K+ R +NL+ +++ LFD + IS V + +Y Y R + TY+ Sbjct: 103 EIFNCCSKKSFRMNFAIFNLYMVLLLLFDAYLWISSVGVRMFQY---YIGR----SFTYY 155 Query: 92 IPNT 81 + NT Sbjct: 156 VCNT 159 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,475 Number of Sequences: 336 Number of extensions: 3993 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -