BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30218.Seq (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 3e-27 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 67 1e-11 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 67 1e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 62 4e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 62 6e-10 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 62 6e-10 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 62 6e-10 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 62 6e-10 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 59 4e-09 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 59 4e-09 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 59 4e-09 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 59 4e-09 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 59 4e-09 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 59 4e-09 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 59 4e-09 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 59 4e-09 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 59 4e-09 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 59 4e-09 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 59 4e-09 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 59 4e-09 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 59 4e-09 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 59 4e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 58 6e-09 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 58 6e-09 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 57 1e-08 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 57 2e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 57 2e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 57 2e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 57 2e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 57 2e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 57 2e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 57 2e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 57 2e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 57 2e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 57 2e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 57 2e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 57 2e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 57 2e-08 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 57 2e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 57 2e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 57 2e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 57 2e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 57 2e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 57 2e-08 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 57 2e-08 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 57 2e-08 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 57 2e-08 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 57 2e-08 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 57 2e-08 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 57 2e-08 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 57 2e-08 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 57 2e-08 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 57 2e-08 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 57 2e-08 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 57 2e-08 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 57 2e-08 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 57 2e-08 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 57 2e-08 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 57 2e-08 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 57 2e-08 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 57 2e-08 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 57 2e-08 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 57 2e-08 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 57 2e-08 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 57 2e-08 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 57 2e-08 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 57 2e-08 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 57 2e-08 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 57 2e-08 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 57 2e-08 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 57 2e-08 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 57 2e-08 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 57 2e-08 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 57 2e-08 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 57 2e-08 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 57 2e-08 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 57 2e-08 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 57 2e-08 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 57 2e-08 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 57 2e-08 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 57 2e-08 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 57 2e-08 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 57 2e-08 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 57 2e-08 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 57 2e-08 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 57 2e-08 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 57 2e-08 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 57 2e-08 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 57 2e-08 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 57 2e-08 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 57 2e-08 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 57 2e-08 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 119 bits (286), Expect = 3e-27 Identities = 55/63 (87%), Positives = 60/63 (95%) Frame = +2 Query: 257 IRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVADPRRCEPKKFGGPGARARYQK 436 IRQAISK+L+A+YQKYVDE SKKEI+DILVQYDRSLLVADPRR E KKFGGPGAR+RYQK Sbjct: 45 IRQAISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQK 104 Query: 437 SYR 445 SYR Sbjct: 105 SYR 107 Score = 54.8 bits (126), Expect(2) = 4e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 156 KLQEPILLLGKEKFSMVDIRVTVKGGGHVAQVY 254 K++EPILLLGKE+F VDIRV VKGGGH +++Y Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIY 43 Score = 20.6 bits (41), Expect(2) = 4e-08 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 30 QAVQVFGRK 56 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 78.2 bits (184), Expect = 7e-15 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -2 Query: 746 RXIGCGPXRLLXPXAKRGNLLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 585 R IG G + P ++G++LQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 49 RAIGAGLFAIT-PAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 76.2 bits (179), Expect = 3e-14 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIPPFRXW 710 SRITIHWPSFYNVVTGKTLALPNLIALQ IPPF W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASW 37 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.5 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 588 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQQIP 695 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQ IP Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.5 bits (170), Expect = 3e-13 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIPPFRXW 710 SRITIHWPSFYNVVTGKTLALPNLIALQ PPF W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASW 37 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIPPFRXW 710 SRITIHWPSFYNVVTGKTLALPNLIAL PPF W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASW 37 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 70.1 bits (164), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 594 PIVSRITIHWPSFYNVVTGKTLALPNLIALQQIP 695 P +SRITIHWPSFYNVVTGKTLALPNLIALQ IP Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +3 Query: 567 EGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQQIPPFRXW 710 +GGA PIRPIVSRITIHWP+FYN TGKTLA L L PPF W Sbjct: 35 DGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASW 80 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIP 695 SRITIHWPSFYNVVTGKTLALPNLIALQ IP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 67.3 bits (157), Expect = 1e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIP 695 SRITIHWPSFYNVVTGKTLALPNLIALQ IP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 716 LXPXAKRGNLLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 585 + P +RG + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 16 ITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 64.1 bits (149), Expect = 1e-10 Identities = 31/54 (57%), Positives = 35/54 (64%) Frame = -2 Query: 746 RXIGCGPXRLLXPXAKRGNLLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 585 R IG G + P +RG + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 15 RAIGAGLFAIT-PAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 662 RQGFPSHDVVKRRPVNCNTTHYRANW 585 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 716 LXPXAKRGNLLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 585 + P +RG + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 10 ITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 656 GFPSHDVVKRRPVNCNTTHYRANW 585 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 656 GFPSHDVVKRRPVNCNTTHYRANW 585 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = -2 Query: 746 RXIGCGPXRLLXPXAKRGNLLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 585 R IG G + P +RG + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 9 RAIGAGLFAIT-PAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 61.7 bits (143), Expect = 6e-10 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIP 695 SRITIHWPSFYNVVTGKTLALPNL L+ IP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIP 32 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 656 GFPSHDVVKRRPVNCNTTHYRANW 585 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 699 KGEFAARRLSWVTPGF 652 KG AARRLSWVTPGF Sbjct: 43 KGGCAARRLSWVTPGF 58 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 656 GFPSHDVVKRRPVNCNTTHYRANW 585 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 656 GFPSHDVVKRRPVNCNTTHYRANW 585 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 61.3 bits (142), Expect = 8e-10 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 618 HWPSFYNVVTGKTLALPNLIALQQIPPFRXW 710 HWPSFYN VTGKTLALPNLIALQ IP F W Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASW 35 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 60.5 bits (140), Expect = 1e-09 Identities = 33/45 (73%), Positives = 33/45 (73%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL*YDSL*GELGTGPPPR 565 KG AARRLSWVTPGFSQSRRCKTTASE D L E PPPR Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPLVLE---RPPPR 70 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFA 112 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFSPXGVIXEXXRNR 739 LAVVLQRRDWENPGVTQLNRLAA+ PF+ G E +R Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNSEEARTDR 106 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 653 FPSHDVVKRRPVNCNTTHYRANW 585 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 3e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 653 FPSHDVVKRRPVNCNTTHYRANW 585 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 59.3 bits (137), Expect = 3e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFSPXGVIXEXXRNR 739 LAVVLQRRDWENPGVTQLNRLAA+ PF+ G E +R Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFTSWGNSEEARTDR 91 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 241 KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 396 KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 312 KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 70 KGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 52 KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 286 KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 470 KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 305 KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 155 KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 606 KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 82 KGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 520 KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASEL 613 KG AARRLSWVTPGFSQSRRCKTTASEL Sbjct: 204 KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 58.4 bits (135), Expect = 6e-09 Identities = 29/53 (54%), Positives = 34/53 (64%) Frame = -2 Query: 746 RXIGCGPXRLLXPXAKRGNLLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 588 R IG G + P +RG + +G +GFPSHD KRRPVNCNTTHYRAN Sbjct: 46 RSIGAGLFAIT-PAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) Length = 120 Score = 58.4 bits (135), Expect = 6e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFSPXGVIXEXXRNR 739 LAVVLQRRDWENPGVTQLNRLAA+ PF+ I E +R Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNIEEARTDR 68 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.4 bits (135), Expect = 6e-09 Identities = 30/49 (61%), Positives = 33/49 (67%) Frame = -1 Query: 759 KLLGKXNRLRXXSXITPXGEKGEFAARRLSWVTPGFSQSRRCKTTASEL 613 +LLGK +R KG+ RRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 QLLGKGDRCGPLRYYASW-RKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 58.4 bits (135), Expect = 6e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 618 HWPSFYNVVTGKTLALPNLIALQQIP 695 HWPSFYNVVTGKTLALPNLIALQ IP Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIP 87 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 58.4 bits (135), Expect = 6e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 618 HWPSFYNVVTGKTLALPNLIALQQIP 695 HWPSFYNVVTGKTLALPNLIALQ IP Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIP 30 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 58.4 bits (135), Expect = 6e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFSPXG 712 LAVVLQRRDWENPGVTQLNRLAA+ PF+ G Sbjct: 131 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG 161 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 58.4 bits (135), Expect = 6e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFSPXG 712 LAVVLQRRDWENPGVTQLNRLAA+ PF+ G Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG 59 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 58.4 bits (135), Expect = 6e-09 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 618 HWPSFYNVVTGKTLALPNLIALQQIP 695 HWPSFYNVVTGKTLALPNLIALQ IP Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIP 82 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 603 SRITIHWPSFYNVVTGKTLALPNLIALQQIPPFRXW 710 SRITIHWPSFYNVVTGKTL++ L L PPF W Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASW 37 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +2 Query: 566 RGGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAANSPFS 703 RGG P+ LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 84 RGGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFA 127 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -1 Query: 699 KGEFAARRLSWVTPGFSQSRRCKTTASE 616 KG AARRLSWVTPGFSQSRRCKTTASE Sbjct: 551 KGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFSPXGVIXEXXRNR 739 LAVVLQRRDWENPGVTQLNRLAA+ PF+ E +R Sbjct: 220 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRTSEEARTDR 259 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFA 62 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFA 89 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFA 71 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFA 63 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFA 89 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFA 94 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFA 65 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFA 85 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFA 97 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFA 73 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFA 62 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFA 52 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFA 77 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFA 86 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFA 80 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFA 96 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFA 84 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFA 67 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFA 243 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFA 138 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFA 76 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFA 55 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFA 43 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFA 74 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFA 408 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFA 134 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFA 110 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFA 66 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFA 35 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFA 45 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFA 65 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFA 130 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFA 72 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFA 367 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFA 107 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFA 77 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFA 43 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFA 86 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFA 70 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFA 161 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFA 90 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFA 66 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFA 170 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFA 860 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFA 43 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFA 87 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFA 61 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFA 100 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFA 83 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFA 96 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFA 283 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFA 141 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFA 77 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFA 63 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFA 64 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFA 128 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFA 141 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFA 66 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFA 47 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFA 85 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFA 64 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFA 61 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFA 38 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFA 46 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFA 423 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFA 72 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFA 81 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFA 63 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFA 146 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFA 82 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFA 92 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFA 95 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFA 441 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFA 138 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFA 94 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFA 83 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFA 73 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFA 76 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFA 188 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFA 92 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFA 79 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFA 115 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFA 64 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFA 90 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFA 69 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFA 212 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFA 61 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFA 67 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFA 81 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFA 78 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFA 61 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFA 62 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFA 76 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFA 66 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFA 159 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFA 68 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFA 111 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFA 49 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFA 180 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFA 367 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFA 84 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFA 48 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFA 136 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFA 113 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFA 63 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFA 87 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFA 321 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFA 84 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFA 85 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFA 43 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFA 63 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFA 438 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFA 122 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFA 78 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFA 70 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFA 120 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFA 70 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFA 238 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFA 70 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFA 240 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFA 60 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFA 75 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFA 65 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFA 70 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFA 174 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFA 72 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFA 62 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFA 82 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFA 67 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFA 102 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFA 222 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFA 80 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFA 59 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFA 113 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFA 49 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFA 76 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFA 214 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFA 84 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFA 94 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFA 77 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFA 84 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFA 127 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFA 103 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFA 56 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFA 123 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 620 LAVVLQRRDWENPGVTQLNRLAANSPFS 703 LAVVLQRRDWENPGVTQLNRLAA+ PF+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFA 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,405,701 Number of Sequences: 59808 Number of extensions: 527921 Number of successful extensions: 4242 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4226 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -