BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30217.Seq (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1163 - 24439976-24440023,24440562-24440597,24440932-244410... 31 1.0 01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738,842... 31 1.0 01_03_0084 - 12286416-12286514,12286632-12286683,12286771-122868... 30 1.8 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 30 2.3 07_03_0834 - 21848064-21849752,21851121-21851850,21852617-21852705 30 2.3 06_03_0914 + 25920277-25920405,25920783-25920810,25920890-259209... 30 2.3 03_05_0724 - 27147479-27147706,27147830-27147920,27148002-271480... 29 3.1 05_06_0102 - 25589011-25589181,25589269-25589496,25589589-255899... 29 4.1 03_06_0003 + 30921197-30921388,30921514-30921632,30921742-309218... 28 7.1 03_05_0525 + 25200207-25200580,25201061-25201751 28 7.1 03_05_0522 - 25161595-25162285,25162394-25163139 28 7.1 03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477,813... 28 7.1 03_01_0107 + 849489-850652,850745-850835,850926-851083,851180-85... 28 7.1 02_04_0203 - 20888010-20888162,20888242-20888469,20888969-208890... 28 7.1 >07_03_1163 - 24439976-24440023,24440562-24440597,24440932-24441018, 24441349-24441492,24441782-24441916,24442215-24442279, 24442395-24442477,24442607-24442642,24443343-24443449, 24443558-24443658,24443750-24443909 Length = 333 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 340 VTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNI 450 V+A+ W + +YS + D V +W+++ G K+T+N+ Sbjct: 243 VSAVTWPERQTIYSASWDHSVRQWDVQTG--KETWNM 277 >01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738, 8421885-8421980,8422064-8422192,8422266-8422445, 8422524-8422634,8422714-8422869,8422983-8423078, 8423160-8423327,8423402-8423642,8423724-8423851, 8424042-8424134,8424214-8424309,8424431-8424523, 8424741-8424850,8424999-8425134,8425215-8425315, 8426029-8426152,8426237-8426411,8426523-8426681, 8427423-8427536,8427669-8427848,8428926-8429005 Length = 1113 Score = 31.1 bits (67), Expect = 1.0 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 5/96 (5%) Frame = +1 Query: 175 SFELKREPKQFKCEYKRK*VPMHSIRHTNGKLLIYSISQ-AKIINVWVPAKHFSAKVTAL 351 SFE P C + ++ + +GK+ + ++ P K + + + Sbjct: 467 SFEGHEAPVYSICPHHKESIQFIFSTSLDGKIKAWLYDHMGSRVDYDAPGKWCTTMLYSA 526 Query: 352 DWSRKYGLYSC--TKDSRVY--EWNIEDGSVKQTYN 447 D +R L+SC +KD Y EWN +GS+K+TY+ Sbjct: 527 DGTR---LFSCGTSKDGDSYLVEWNESEGSIKRTYS 559 >01_03_0084 - 12286416-12286514,12286632-12286683,12286771-12286871, 12287498-12287650,12287703-12287762,12287872-12287998, 12288581-12288708,12289196-12289291,12289473-12289526, 12289603-12289689,12290954-12291057,12291163-12291246, 12291374-12291422,12291523-12291886,12292186-12292226 Length = 532 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWGTETNVLKQEYTP 112 A+FS DG T + D +K+W T+T Q + P Sbjct: 359 AIFSTDGSRVITASSDCTVKVWDTKTTDCLQTFKP 393 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWGTETNVLKQE 103 A FS DG+Y + + DG +++W + LK++ Sbjct: 224 ARFSPDGQYLVSCSVDGIIEVWDYISGKLKKD 255 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 391 DSRVYEWNIEDGSVKQTYN 447 DS + EWN +G++K+TYN Sbjct: 583 DSHLVEWNETEGAIKRTYN 601 >07_03_0834 - 21848064-21849752,21851121-21851850,21852617-21852705 Length = 835 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 7/45 (15%) Frame = -3 Query: 549 MMQLLSTGISCADWWYN--FY-----GVYIAPLLRIIFNRNIIGL 436 ++++ G++ DWW N FY GVY+A +L I+ R ++GL Sbjct: 642 LVEIKWAGLTLLDWWRNEQFYMIGATGVYLAAVLHIVLKR-LLGL 685 >06_03_0914 + 25920277-25920405,25920783-25920810,25920890-25920990, 25921356-25921479,25921793-25921903,25922222-25922397, 25922766-25922848,25922935-25923007,25923630-25923695, 25923776-25923818,25924600-25924739,25924878-25925090, 25925397-25925481,25925558-25925852,25926855-25927110, 25927237-25927450,25927701-25927912,25928054-25928203 Length = 832 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWGTETNVLKQEYTPDLHLTSTLPTCPTVD 157 FSEDGK+ + + DG L+IW D+ +TS L P +D Sbjct: 495 FSEDGKWLISSSMDGTLRIWDISLARQIDAMHVDVSITS-LSMSPNMD 541 >03_05_0724 - 27147479-27147706,27147830-27147920,27148002-27148060, 27148197-27148312,27148389-27148472,27148677-27148824, 27148958-27149103,27149610-27149729,27149900-27149998, 27150787-27150828,27150915-27151017 Length = 411 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWGTETNVLK 97 FS DG ++ + DGR+ +W T T L+ Sbjct: 132 FSSDGNLLASGSFDGRINVWNTATRTLQ 159 >05_06_0102 - 25589011-25589181,25589269-25589496,25589589-25589933, 25590406-25590777,25590957-25591049,25591150-25591401, 25592019-25593224 Length = 888 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 361 RKYGLYSCTKDSRVYEWNIEDGS 429 R G Y+ TKD ++ WN+ +GS Sbjct: 202 RVTGAYTITKDGAIFTWNLVEGS 224 >03_06_0003 + 30921197-30921388,30921514-30921632,30921742-30921811, 30922078-30922161,30922258-30922344,30922431-30922501, 30922648-30922702,30923374-30923509,30925009-30925103, 30925203-30925357,30925435-30925543,30925761-30925817, 30925913-30926027,30926177-30926264,30926738-30927501, 30927600-30927688,30928315-30928422,30928550-30928657, 30928887-30928977,30929235-30929287,30929557-30929712, 30930763-30930825,30931491-30931535,30932075-30932130, 30933051-30933132,30933238-30933354,30933428-30933530, 30933912-30934062,30934180-30934417,30934564-30934764, 30934850-30934935,30935036-30935135 Length = 1347 Score = 28.3 bits (60), Expect = 7.1 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +1 Query: 259 NGKLLIYSISQAKIINVWVPAKHFSAKVTALDWSR--KYGLYSCTKDSRVYEWNIEDGSV 432 +G L I+ A+ + + A H SA+VT+ +++ +Y L SC KDS + W + G + Sbjct: 319 DGSLRIWDGISAECVRPIIGA-HASAEVTSAIFTKDERYVL-SCGKDSCIKLWEVGSGRL 376 Query: 433 KQTY 444 + Y Sbjct: 377 VKQY 380 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 5 EAMFSEDGKYYSTITKDGRLKIW 73 + +S G Y T +KDG L+IW Sbjct: 303 QVRYSSTGSLYVTASKDGSLRIW 325 >03_05_0525 + 25200207-25200580,25201061-25201751 Length = 354 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 17 SEDGKYYSTITKDGRLKIW 73 SE G Y +++T DGRL IW Sbjct: 154 SEKGVYLASLTIDGRLSIW 172 >03_05_0522 - 25161595-25162285,25162394-25163139 Length = 478 Score = 28.3 bits (60), Expect = 7.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 17 SEDGKYYSTITKDGRLKIW 73 SE G Y +++T DGRL IW Sbjct: 278 SEKGVYLASLTIDGRLSIW 296 >03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477, 8136560-8136655,8136746-8136874,8136947-8137123, 8137256-8137366,8138592-8138792,8139022-8139186, 8139293-8139527,8139618-8139745,8139833-8139928, 8140017-8140112,8140252-8140325,8140393-8140462, 8140556-8140665,8140753-8140906,8141040-8141155, 8141259-8141379,8141464-8141641,8142331-8142489, 8142619-8142732,8142821-8143000,8143098-8143177 Length = 1117 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = +1 Query: 373 LYSC--TKD--SRVYEWNIEDGSVKQTY 444 L+SC +KD S + EWN +G+VK+TY Sbjct: 560 LFSCGTSKDGESHLVEWNESEGAVKRTY 587 >03_01_0107 + 849489-850652,850745-850835,850926-851083,851180-851231, 852373-852452,852540-852633,852711-853231,854087-854202, 854242-854293 Length = 775 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWGTETNVLKQEYTPDLHLTSTLPTC 145 FS DG+Y +T +DG +++W V++ E +L P+C Sbjct: 279 FSSDGQYLATGGEDGVVRVW----RVVEGERPNELDFAEDDPSC 318 >02_04_0203 - 20888010-20888162,20888242-20888469,20888969-20889073, 20889148-20889225,20889308-20889382,20890037-20890123, 20890216-20890283,20890396-20890483,20890583-20890683, 20890793-20890913,20891008-20891169,20891271-20891441 Length = 478 Score = 28.3 bits (60), Expect = 7.1 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 379 SCTKDSRVYEWNIE---DGSVKQTYNISIENNTKQGSNINAIKIIPPISTRNPG 531 S T D + EW DGS++ ++ + + G INA+K+I PI + PG Sbjct: 119 SGTYDKNIEEWPQRGGADGSLR--FDAELSHGANAGL-INALKLIQPIKDKYPG 169 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,901,349 Number of Sequences: 37544 Number of extensions: 389332 Number of successful extensions: 865 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -