BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30213.Seq (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58396| Best HMM Match : Acetyltransf_1 (HMM E-Value=0.0096) 28 7.2 SB_27772| Best HMM Match : Ank (HMM E-Value=0.98) 28 9.5 >SB_58396| Best HMM Match : Acetyltransf_1 (HMM E-Value=0.0096) Length = 236 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 143 FNYQKKMESKYFMQTLNLTVKIYRGVKGYHSLNFEKNTQQKTFNC 277 F + ESKY Q L V ++ +GYH L F + C Sbjct: 159 FGVLRSHESKYINQLLLSEVVMFAEDQGYHKLIFYSSNNSSLLTC 203 >SB_27772| Best HMM Match : Ank (HMM E-Value=0.98) Length = 340 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = -1 Query: 323 NSMFLIELQLSLHRSNS*KFFVVYFFQSLNYDSLSPLYIF*RLSSMSA*NIYSPFSFDN 147 +S L+++ +R+ + ++ YFF +N D+L P++ L+ +Y F F+N Sbjct: 173 SSELSFNLRVNAYRALANPLYISYFF-IMNPDALHPIFHVLELNKKLKNQMYRDFEFNN 230 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,029,183 Number of Sequences: 59808 Number of extensions: 478238 Number of successful extensions: 1072 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -