BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30213.Seq (767 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT029934-1|ABM92808.1| 1442|Drosophila melanogaster IP14638p pro... 29 7.0 AE013599-3499|AAF46925.1| 1439|Drosophila melanogaster CG3695-PA... 29 7.0 >BT029934-1|ABM92808.1| 1442|Drosophila melanogaster IP14638p protein. Length = 1442 Score = 29.1 bits (62), Expect = 7.0 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 487 GPLITKIMSLKPNSLSPLSMFHSYVNIII*KSHNSTVCRY-GIVCDWLVRVAWIY-GN 654 GP + +I KPN+++ +++ + I+ K H +Y +CD+L + +I+ GN Sbjct: 1245 GPFLQRIELEKPNAVAGIAVLLYEILEIVDKHHGPKPLQYMDQICDFLYHIKYIHVGN 1302 >AE013599-3499|AAF46925.1| 1439|Drosophila melanogaster CG3695-PA protein. Length = 1439 Score = 29.1 bits (62), Expect = 7.0 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 487 GPLITKIMSLKPNSLSPLSMFHSYVNIII*KSHNSTVCRY-GIVCDWLVRVAWIY-GN 654 GP + +I KPN+++ +++ + I+ K H +Y +CD+L + +I+ GN Sbjct: 1243 GPFLQRIELEKPNAVAGIAVLLYEILEIVDKHHGPKPLQYMDQICDFLYHIKYIHVGN 1300 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,993,204 Number of Sequences: 53049 Number of extensions: 686980 Number of successful extensions: 1577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1573 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3540671772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -