BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30212.Seq (759 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0560 + 30244814-30244871,30244979-30245140,30245725-302457... 29 5.3 07_03_0265 + 15976331-15976645,15977575-15977784,15977869-159779... 28 7.0 12_02_0437 - 19084990-19087695 28 9.3 02_01_0729 - 5465521-5466005,5466481-5466793,5466878-5467094,546... 28 9.3 >01_06_0560 + 30244814-30244871,30244979-30245140,30245725-30245786, 30246170-30246214,30246358-30246363,30246424-30246624, 30246735-30248024 Length = 607 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 577 EIKAVAAGRAHTIILTDKEGVYTLG 651 ++ AVAAG AHT+ LT VY+ G Sbjct: 4 KVVAVAAGEAHTLALTGDGEVYSWG 28 >07_03_0265 + 15976331-15976645,15977575-15977784,15977869-15977916, 15978307-15978675,15978736-15978747,15978763-15978870, 15979156-15979493,15980313-15980430,15983247-15984107, 15984457-15984750 Length = 890 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 565 SLECEIKAVAAGRAHTIILTDKEGVYTLGNN 657 SL C VA G + T+ILT VYT G+N Sbjct: 184 SLCCGHGEVATGLSFTVILTTDGQVYTCGSN 214 >12_02_0437 - 19084990-19087695 Length = 901 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 67 LIVVCLEI*LICMQLNF*YTGEVLFSC*IEFP 162 LI +C L+C++LN Y GE L C FP Sbjct: 789 LISLCKMANLVCLELNCAYDGEALRFCAEWFP 820 >02_01_0729 - 5465521-5466005,5466481-5466793,5466878-5467094, 5467797-5468116 Length = 444 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 541 APIYIP--YKSLECEIKAVAAGRAHTIILTDKEGVYTLGNN 657 A +Y+P SL + AVAAG H++ ++ + V+ G N Sbjct: 54 ADVYVPTPVPSLPTSVAAVAAGHYHSLAVSAEGEVWAWGRN 94 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,537,049 Number of Sequences: 37544 Number of extensions: 395167 Number of successful extensions: 928 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -