BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30206.Seq (533 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 24 0.97 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 1.7 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 2.2 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 6.8 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 6.8 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 6.8 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 23.8 bits (49), Expect = 0.97 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 255 IELERGKEKIIFLYSTTTSITLVAAPTPSNKYYNSTSTKPVP 380 +E R E ++ L +T S + + P+PS ST+ P P Sbjct: 108 VEYIRSLEDLLALDESTVSSSTSSIPSPSTTDDLSTNPTPPP 149 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 23.0 bits (47), Expect = 1.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 246 QLVDIVFLSTRNLLTPLNFINLVLLQLNIMVGKLLTH 136 QLV I L+T+ T +F NL ++M+ L T+ Sbjct: 329 QLVAIRLLNTKLQFTAKDFFNLDWTFCHMMIAALTTY 365 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.6 bits (46), Expect = 2.2 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = -3 Query: 189 INLVLLQLNIMVGKLLTHSFTSYLMKVLISSINYYTPTLQNVCMY 55 ++ ++ QLN G +L FTS+ + +++S + N M+ Sbjct: 222 LSKLIKQLNATYGLILLLMFTSHFIFIVVSIFYMSAYLISNPIMW 266 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 336 PSNKYYNSTSTKP 374 PS+ YYN TS P Sbjct: 18 PSDNYYNYTSDIP 30 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 336 PSNKYYNSTSTKP 374 PS+ YYN TS P Sbjct: 18 PSDNYYNYTSDIP 30 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 336 PSNKYYNSTSTKP 374 PS+ YYN TS P Sbjct: 18 PSDNYYNYTSDIP 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,777 Number of Sequences: 336 Number of extensions: 2177 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -