BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30203.Seq (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 25 0.55 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 24 1.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 2.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 2.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 2.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.8 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 6.8 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 22 6.8 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 22 6.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 6.8 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 9.0 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 25.4 bits (53), Expect = 0.55 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 367 YLFYSLIFMNVVPNLLILVPIF 432 +LF LIF++V N+L+ V I+ Sbjct: 30 FLFLILIFLSVAGNILVCVAIY 51 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 24.2 bits (50), Expect = 1.3 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 61 NQYGRSKSASRRH-WSTKRHPSLESSHHCQ*NRRSSLGGPRNHRAVYH 201 N+ S + RRH + PS E + SSL RNH+++YH Sbjct: 9 NKILTSLTRLRRHIQNVHTRPSKEPICNICKRVYSSLNSLRNHKSIYH 56 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 271 SQRSRVRFVECRHWIVKQWEHVSNGTQHGDYADP 170 S RS+ F+ H W + HGD+ DP Sbjct: 125 SNRSQYEFLNAIHHYDDIWLPDTYFIMHGDFKDP 158 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 271 SQRSRVRFVECRHWIVKQWEHVSNGTQHGDYADP 170 S RS+ F+ H W + HGD+ DP Sbjct: 125 SNRSQYEFLNAIHHYDDIWLPDTYFIMHGDFKDP 158 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 271 SQRSRVRFVECRHWIVKQWEHVSNGTQHGDYADP 170 S RS+ F+ H W + HGD+ DP Sbjct: 176 SNRSQYEFLNAIHHYDDIWLPDTYFIMHGDFKDP 209 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 271 SQRSRVRFVECRHWIVKQWEHVSNGTQHGDYADP 170 S RS+ F+ H W + HGD+ DP Sbjct: 125 SNRSQYEFLNAIHHYDDIWLPDTYFIMHGDFKDP 158 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 6.8 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +3 Query: 585 VPGSYSSWHCSVTAGLMSPFVYY 653 +P +YS W+ + L + +Y+ Sbjct: 201 IPANYSGWYLNHDYNLENKLIYF 223 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 283 RLHQRIPAREISLSR 327 RLH R+P R +L R Sbjct: 108 RLHSRLPGRNFNLLR 122 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 369 IVSAVLQEEPRHEIPREGD 313 +V+ VLQ P E+ + GD Sbjct: 26 LVNTVLQPRPSFELSKNGD 44 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 369 IVSAVLQEEPRHEIPREGD 313 +V+ VLQ P E+ + GD Sbjct: 28 LVNTVLQPRPSFELSKNGD 46 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -2 Query: 524 GDEQTTTHNEF*PRVSRIVKEYEAACSSANKKIGTNI 414 G+ + T+N P+V VK + C+ N +N+ Sbjct: 131 GNSRANTYNFDYPQVPYTVKNFHPRCAVNNYNDPSNV 167 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 330 FHGEVLPGGQRSLFILFTHFHERRAQF 410 F +L SLF++ HF R +F Sbjct: 278 FVNNILAASACSLFVVIFHFAHPREEF 304 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -3 Query: 151 FIGNDVSFQGWDAFWWTSVACLLI 80 F ND+ +QG WT + I Sbjct: 285 FQANDIQYQGASDILWTQASAKAI 308 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,351 Number of Sequences: 438 Number of extensions: 4206 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -