BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30201.Seq (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 28 0.31 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 28 0.31 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 24 5.0 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 24 5.0 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 5.0 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 5.0 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 5.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.6 AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 23 6.6 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 27.9 bits (59), Expect = 0.31 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 261 KCIVFIRPTSENIALLSRELRDPKYGVYFIY 353 KC+ F RP S ALL+ E + Y + F + Sbjct: 158 KCVPFCRPFSGQTALLTPESQSANYALTFAF 188 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 27.9 bits (59), Expect = 0.31 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 174 VQSIGNLTEGSLLIREDRQSC 236 ++ +G T G ++IRED QSC Sbjct: 849 MKDVGEKTTGPIVIREDNQSC 869 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 404 ITFGQSFDVCLRNYITE 354 +T GQ+FD+ R Y+++ Sbjct: 139 LTIGQAFDLAYRRYVSD 155 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 404 ITFGQSFDVCLRNYITE 354 +T GQ+FD+ R Y+++ Sbjct: 139 LTIGQAFDLAYRRYVSD 155 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 404 ITFGQSFDVCLRNYITE 354 +T GQ+FD+ R Y+++ Sbjct: 139 LTIGQAFDLAYRRYVSD 155 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 404 ITFGQSFDVCLRNYITE 354 +T GQ+FD+ R Y+++ Sbjct: 139 LTIGQAFDLAYRRYVSD 155 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 5.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 404 ITFGQSFDVCLRNYITE 354 +T GQ+FD+ R Y+++ Sbjct: 139 LTIGQAFDLAYRRYVSD 155 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 370 ETTLLKYIK*TPYLGSLSSRDNRAMFSD 287 +TTL+ Y Y+GSL N + SD Sbjct: 836 QTTLMSYSSNNDYIGSLVQVKNALVSSD 863 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 452 GCGQTPVLFQYCXMPPRSGWNQQHL 526 GCG+ + Y +P GW HL Sbjct: 182 GCGEDGIPGVYVNVPMFRGWIDDHL 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,997 Number of Sequences: 2352 Number of extensions: 12891 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -