BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30200.Seq (809 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 24 4.8 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 24 4.8 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 24 4.8 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 24 4.8 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 23 8.4 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411 ++GD E AV ++GF A+G G GG Sbjct: 201 TIGD-EQQSHAVSPNQRGFSASGGGGSGG 228 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411 ++GD E AV ++GF A+G G GG Sbjct: 201 TIGD-EQQSHAVSPNQRGFSASGGGGSGG 228 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411 ++GD E AV ++GF A+G G GG Sbjct: 201 TIGD-EQQSHAVSPNQRGFSASGGGGSGG 228 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411 ++GD E AV ++GF A+G G GG Sbjct: 201 TIGD-EQQSHAVSPNQRGFSASGGGGSGG 228 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 680 TFLYSIGP-GLPPRRSTAKXATEKTALRWYN 591 TF S+ P GLP + T K T T W N Sbjct: 144 TFSDSVQPVGLPKQDETVKDGTMTTVSGWGN 174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,778 Number of Sequences: 2352 Number of extensions: 11975 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -