BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30184.Seq (455 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) 66 2e-11 SB_28994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_5012| Best HMM Match : 7tm_3 (HMM E-Value=0) 27 7.4 SB_13108| Best HMM Match : PRRSV_2b (HMM E-Value=6.1) 27 9.7 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) Length = 131 Score = 65.7 bits (153), Expect = 2e-11 Identities = 36/74 (48%), Positives = 43/74 (58%) Frame = +2 Query: 35 KVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYH 214 KVK ELR K + LRVAKVTGG ASKLSKI+VVRK++ARV V Sbjct: 11 KVKAHELRGKKKDELLKQLDELKTELSQLRVAKVTGGAASKLSKIKVVRKSVARVLTVVS 70 Query: 215 QKMKVNLRNHYKNR 256 Q + NLR Y+ + Sbjct: 71 QTQRDNLRKFYRKK 84 Score = 46.0 bits (104), Expect = 1e-05 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 271 DLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVK 393 DLR K TRAMR++LTK EA KT K+ +K + F R YAVK Sbjct: 90 DLRPKLTRAMRRSLTKKEASSKTLKQQKKLAHFSLRKYAVK 130 >SB_28994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 28.7 bits (61), Expect = 2.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 128 AKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNRNTS 265 A+ T A +K+R + + YI+Y +K + NL++ +N TS Sbjct: 56 AEKTRNYAGLFAKLRAKLRVLRPNYILYRRKARNNLKSLRRNSGTS 101 >SB_5012| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 726 Score = 27.1 bits (57), Expect = 7.4 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 380 TLGGKRDFFLISFLVLIFASCLVRALRIARVFLALKS 270 TL G R F L++ S LV+ RIAR+F KS Sbjct: 511 TLCGIRRFGTGISFCLLYTSLLVKTNRIARIFSGTKS 547 >SB_13108| Best HMM Match : PRRSV_2b (HMM E-Value=6.1) Length = 311 Score = 26.6 bits (56), Expect = 9.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 271 DLRAKKTR-AMRKALTKHEAKIKTRKEIRKKSLFPPRVYA 387 DL K T +M + KH AK+ R E++ S PP V A Sbjct: 112 DLVEKSTPCSMDNSRQKHIAKLLLRSEMKGNSELPPHVQA 151 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 267 FRFKSQEDPCYAQGSY*TRSKDQDEERD 350 F S DP Y G Y D+DEE D Sbjct: 1207 FNVTSGSDPDYGNGDYDYDENDEDEEGD 1234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,219,812 Number of Sequences: 59808 Number of extensions: 156231 Number of successful extensions: 450 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 920703675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -