BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30182.Seq (827 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0971 - 33483015-33483071,33483282-33483315,33483590-334836... 47 2e-05 03_02_0594 - 9695616-9696042,9696646-9697260,9697410-9697717,970... 47 2e-05 10_08_0340 - 16934317-16934478,16934569-16934745,16934842-169349... 30 2.6 01_06_1437 - 37358912-37359226 29 4.5 02_05_0376 + 28406547-28406870 28 7.9 >01_06_0971 - 33483015-33483071,33483282-33483315,33483590-33483684, 33483769-33483843,33483925-33484010,33484256-33484307, 33484381-33484455,33484554-33484620,33485699-33486159 Length = 333 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/57 (40%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -3 Query: 672 IITTWH---WGLLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFISL 511 I+ W+ +G L +G +D LDG++AR G ++ GS+LDP+ADKVL+ + I++ Sbjct: 156 IVNEWYLPAFGTLALSGASDWLDGFLARKM-GINSVFGSYLDPLADKVLIGCVAIAM 211 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 3/80 (3%) Frame = -2 Query: 505 QDLIPISLTLLIVGRDIALVVAGFVIRYISLPPP-RTLSRY--FDVTHATAQLAPTFISK 335 +DL+ L L+V RD+ LV R SL + S + D H ++ P FISK Sbjct: 214 KDLLHPGLVGLVVVRDLLLVGGAVYKRASSLGWKWNSWSDFVNLDAIHRE-KVKPLFISK 272 Query: 334 VNTAVQLLLVGTTLASPVFG 275 VNT QL+LV L P FG Sbjct: 273 VNTVFQLMLVAAALLQPEFG 292 >03_02_0594 - 9695616-9696042,9696646-9697260,9697410-9697717, 9700145-9700235,9700698-9700759,9701256-9702962, 9703789-9703870,9703972-9704057,9704855-9704968, 9705113-9705163,9705261-9705358,9707084-9707546 Length = 1367 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = -3 Query: 651 GLLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFISL 511 G+ + A +TD LDG+IAR + T G+FLDP+ADK++VA + L Sbjct: 169 GIFLAAAVTDWLDGYIARKMQ-LGTPFGAFLDPVADKLMVAATLVLL 214 >10_08_0340 - 16934317-16934478,16934569-16934745,16934842-16934940, 16935025-16935225,16935389-16935409,16935554-16935661, 16935749-16936130,16936693-16936912,16938673-16938827, 16938960-16939183,16939648-16939707 Length = 602 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 690 LCNNPGIITTWHWGLL-VFAGITDLLDGWIARNWKGQSTK 574 + NPG+ T W W L F + LL W+A W +TK Sbjct: 1 MATNPGLFTEWPWKKLGSFKYV--LLAPWVAHGWYEVATK 38 >01_06_1437 - 37358912-37359226 Length = 104 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 412 PPPRTLSRYFDVTHATAQLAPTFI 341 PPPR L R + H++ +L P F+ Sbjct: 60 PPPRALDRLISLRHSSLELLPLFL 83 >02_05_0376 + 28406547-28406870 Length = 107 Score = 28.3 bits (60), Expect = 7.9 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +2 Query: 647 SPQCQVVII--PGLLHNPKYGRHCYSSDT*SGLG*WKDIFFPYNFPQIFP 790 SP C+ I PG H+ +S S L W+++ PYNFP + P Sbjct: 5 SPSCKATICRTPGNHHHGTTSELRAASRRASSL--WEEMVLPYNFPPLSP 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,526,145 Number of Sequences: 37544 Number of extensions: 422151 Number of successful extensions: 785 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -