BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30182.Seq (827 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 25 2.2 Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 23 8.7 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 25.4 bits (53), Expect = 2.2 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 817 YFRKLKLKSRKDLGEVVGEENVLPLSQTTLGITRIAMSPIFR 692 Y R K +G++ G +P + LGI I +SPIF+ Sbjct: 33 YPRSFKDSDGDGVGDLRGIMEKVPYLRRELGIDAIWLSPIFK 74 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 189 GHLQITKEKNMNIVKYCEISLFPFRDYFLLFSKF 88 GH+ I +V+ C + L+ RDY K+ Sbjct: 59 GHISIRGRILTGVVRKCIVLLYIRRDYLQFIRKY 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 819,816 Number of Sequences: 2352 Number of extensions: 16107 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -