BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30181.Seq (432 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC15C4.05 |||ATP-dependent RNA/DNA helicase |Schizosaccharomyc... 25 3.8 SPAC22A12.08c |||cardiolipin synthase/ hydrolase fusion protein ... 25 6.6 SPCC1322.02 |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 24 8.7 SPCC1739.03 |hrr1||Helicase Required for RNAi-mediated heterochr... 24 8.7 >SPBC15C4.05 |||ATP-dependent RNA/DNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1428 Score = 25.4 bits (53), Expect = 3.8 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 320 SCSTSIGRHYAGVPSFWLC*SSALKVLCGITAASTIVSAVSY 195 S SI R +A +P S ++LCG+ AAS + + Y Sbjct: 1240 SLKRSICRRFAVIPKEHDINSGNAEILCGVIAASLYPNILRY 1281 >SPAC22A12.08c |||cardiolipin synthase/ hydrolase fusion protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 570 Score = 24.6 bits (51), Expect = 6.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 385 RYFDVTHATAQLAPTFISKV 326 R+FD T +L PT ISKV Sbjct: 516 RFFDFAIPTTELKPTRISKV 535 >SPCC1322.02 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 24.2 bits (50), Expect = 8.7 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -3 Query: 295 TTLASPVFGYVDHPH*KSCVELLQPQL*CQPSVI*LVRTPTNY*RKKYEY 146 TTL S +H K LL PQ+ C ++ R+P +K Y Y Sbjct: 260 TTLESDPIVNCEHDEKKVADNLLVPQVMCSSNISTFFRSPGG--KKLYHY 307 >SPCC1739.03 |hrr1||Helicase Required for RNAi-mediated heterochromatin assembly Hrr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1015 Score = 24.2 bits (50), Expect = 8.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 325 NTAVQLLLVGTTLASPVFGYVDHPH 251 N Q +GT A P+ G HPH Sbjct: 249 NDDFQTFRIGTVCARPLSGLNKHPH 273 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,669,250 Number of Sequences: 5004 Number of extensions: 31121 Number of successful extensions: 44 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -