BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30176.Seq (834 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39695| Best HMM Match : Pecanex_C (HMM E-Value=0) 32 0.66 SB_56399| Best HMM Match : DUF23 (HMM E-Value=1.9e-28) 29 4.6 SB_45633| Best HMM Match : DUF23 (HMM E-Value=3.2e-35) 29 4.6 SB_41280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 >SB_39695| Best HMM Match : Pecanex_C (HMM E-Value=0) Length = 1048 Score = 31.9 bits (69), Expect = 0.66 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = +1 Query: 268 TGETYPIQNI--PIPLKFPAEINEGIWGGEAVVKGFQKRDDRRRRVPHYWVPVLKRTVVR 441 TG+ Y N+ PI +++P+E I GGE K + + V H W+P R Sbjct: 930 TGQVYDSINLCRPIDVQWPSE-QMRIKGGEKFWKDWHPEEGMVGVVVHRWLPNHPDPARR 988 Query: 442 SEVLNTHLSVTVTDRTI 492 S V T L V + D + Sbjct: 989 SHVNRTILLVKIEDHYV 1005 >SB_56399| Best HMM Match : DUF23 (HMM E-Value=1.9e-28) Length = 419 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -1 Query: 399 YPASSIITLLETFNHSFSSPYPLIDFSGEFKRNRNILYRISFTSQFVAFH 250 Y + + ++L ++ + I + G+ ++ LYR TS+FVAFH Sbjct: 225 YESKGVASVLTWVMPAYMLDFYSIHYHGQMLSIQDCLYRARGTSRFVAFH 274 >SB_45633| Best HMM Match : DUF23 (HMM E-Value=3.2e-35) Length = 334 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -1 Query: 399 YPASSIITLLETFNHSFSSPYPLIDFSGEFKRNRNILYRISFTSQFVAFH 250 Y + + ++L ++ + I + G+ ++ LYR TS+FVAFH Sbjct: 140 YESKGVASVLTWVMPAYMLDFYSIHYHGQMLSIQDCLYRARGTSRFVAFH 189 >SB_41280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 2 IVTH*NSVNIFPQRFMLPKKL*SNSMASSRLQVTA 106 I+T N +N +P+R L K + NS+A+ R T+ Sbjct: 304 IITPGNDLNSYPRRSRLKKPISRNSLATDRFSYTS 338 >SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 582 FSVSMLVQRLNHKQESSVDN-GQTHRIINETNSSIRYSY*EMSIENFRSYYSSLQY 418 FS Q+ N+ +E VD G ++ N N R + E ++ +YYS+ +Y Sbjct: 122 FSRENTFQQRNNNKEDIVDKIGNRKKLKNRANPRTRTHFTERQLKYLETYYSNGRY 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,723,923 Number of Sequences: 59808 Number of extensions: 444821 Number of successful extensions: 1012 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -