BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30176.Seq (834 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01800.1 68417.m00237 preprotein translocase secA subunit, pu... 30 1.6 At3g02210.1 68416.m00202 phytochelatin synthetase family protein... 29 3.8 At4g12440.1 68417.m01968 adenine phosphoribosyltransferase, puta... 29 5.0 At3g29810.1 68416.m03794 phytochelatin synthetase family protein... 29 5.0 At3g18860.2 68416.m02396 transducin family protein / WD-40 repea... 29 5.0 At3g18860.1 68416.m02395 transducin family protein / WD-40 repea... 29 5.0 At1g77320.1 68414.m09005 BRCT domain-containing protein contains... 29 5.0 At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehy... 28 8.8 At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehy... 28 8.8 At2g33420.1 68415.m04096 expressed protein 28 8.8 >At4g01800.1 68417.m00237 preprotein translocase secA subunit, putative similar to preprotein translocase secA subunit, chloroplast [precursor] SP:Q9SYI0 from [Arabidopsis thaliana]; non-consensus GA donor splice site at exon 4 Length = 1022 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +1 Query: 379 DDRRRRVPHYWVPVLKRTVVRSEVLNTHLSVTVTDRTISLINDPMGLTII 528 D+ +R+V +Y+ + K+ EVLN+ T+R +L++D + II Sbjct: 774 DEAQRKVENYFFDIRKQLFEFDEVLNSQRDRVYTERRRALVSDSLEPLII 823 >At3g02210.1 68416.m00202 phytochelatin synthetase family protein / COBRA cell expansion protein COBL3 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); supported by cDNA: gi|26452134|dbj|AK118555.1; contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 452 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = -1 Query: 465 EMSIENFRSYYSSLQYWHPVVRYPASSIITLLETFNHSFSSPYPLIDFSG 316 +++I NF +Y + W+ VV++P +T +FN+ +PY I+ +G Sbjct: 312 KVTITNF-NYNMNYSQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTG 360 >At4g12440.1 68417.m01968 adenine phosphoribosyltransferase, putative strong similarity to SP|P31166 Adenine phosphoribosyltransferase 1 (EC 2.4.2.7) (APRT) {Arabidopsis thaliana}; contains Pfam profile PF00156: Phosphoribosyl transferase domain Length = 178 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 96 CKREDAIELLYSFFGSINLWGKILTEFQWVTI 1 C + + +SFF +I+L K+L F+W+ I Sbjct: 139 CAAMNLLSKFFSFFNNISLVPKLLLSFKWLPI 170 >At3g29810.1 68416.m03794 phytochelatin synthetase family protein / COBRA cell expansion protein COBL2 similar to phytochelatin synthetase [Hordeum vulgare subsp. vulgare] GI:29570314; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 441 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = -1 Query: 465 EMSIENFRSYYSSLQYWHPVVRYPASSIITLLETFNHSFSSPY 337 +++I NF +Y + W+ VV++P +T L +FN+ +PY Sbjct: 303 KVAITNF-NYNMNYSQWNLVVQHPNFDNLTKLFSFNYKPLNPY 344 >At3g18860.2 68416.m02396 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/69 (21%), Positives = 29/69 (42%) Frame = -1 Query: 552 NHKQESSVDNGQTHRIINETNSSIRYSY*EMSIENFRSYYSSLQYWHPVVRYPASSIITL 373 N K + ++ + I+N + Y + + LQ W P + +PA+ I+ + Sbjct: 522 NDKSLTELEVSRVGAIVNILKDTSHYHSTNFADMDIALLLKVLQAWPPAMMFPATDIVRM 581 Query: 372 LETFNHSFS 346 L +H S Sbjct: 582 LVLHHHGAS 590 >At3g18860.1 68416.m02395 transducin family protein / WD-40 repeat family protein contains seven G-protein beta WD-40 repeats; similar to phospholipase a-2-activating protein SP:P27612 from [Mus musculus] Length = 760 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/69 (21%), Positives = 29/69 (42%) Frame = -1 Query: 552 NHKQESSVDNGQTHRIINETNSSIRYSY*EMSIENFRSYYSSLQYWHPVVRYPASSIITL 373 N K + ++ + I+N + Y + + LQ W P + +PA+ I+ + Sbjct: 522 NDKSLTELEVSRVGAIVNILKDTSHYHSTNFADMDIALLLKVLQAWPPAMMFPATDIVRM 581 Query: 372 LETFNHSFS 346 L +H S Sbjct: 582 LVLHHHGAS 590 >At1g77320.1 68414.m09005 BRCT domain-containing protein contains Pfam profile PF00533: BRCA1 C Terminus (BRCT) domain Length = 783 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +1 Query: 226 TFRSSRREVERDELTGETYPIQNIPIPLKFPAEINEGIWGGEAVVKGFQKRD 381 TF S + ++ RD + +P++ +P P+ +GI G V G + D Sbjct: 625 TFPSKKAKLLRDGQESDVFPVRELPSNCDRPSHSGDGIVTGYDVASGREVPD 676 >At2g41540.2 68415.m05134 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 5/65 (7%) Frame = +1 Query: 232 RSSRREVERDELTGETYPIQNI--PI-PLKFPAEINEGIWGGEAVVKGFQKRDDRR--RR 396 R R + DE+ + + + + P+ PLK + E +W + VV G + R Sbjct: 118 RLGDRTLYADEILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEE 177 Query: 397 VPHYW 411 + YW Sbjct: 178 ISKYW 182 >At2g41540.1 68415.m05133 NAD-dependent glycerol-3-phosphate dehydrogenase family protein weak similarity to SP|P46919 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) {Bacillus subtilis}; contains Pfam profile PF01210: NAD-dependent glycerol-3-phosphate dehydrogenase Length = 462 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 5/65 (7%) Frame = +1 Query: 232 RSSRREVERDELTGETYPIQNI--PI-PLKFPAEINEGIWGGEAVVKGFQKRDDRR--RR 396 R R + DE+ + + + + P+ PLK + E +W + VV G + R Sbjct: 118 RLGDRTLYADEILKDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEE 177 Query: 397 VPHYW 411 + YW Sbjct: 178 ISKYW 182 >At2g33420.1 68415.m04096 expressed protein Length = 1039 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 275 KLIRYKIFLFLLNSPLKSMRGYGEEKL 355 KL R +++ LLNS L SM+G+ E++L Sbjct: 405 KLDREALYVKLLNSTLASMQGWTEKRL 431 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,435,119 Number of Sequences: 28952 Number of extensions: 328526 Number of successful extensions: 883 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1921616800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -