BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30174.Seq (853 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|ch... 26 7.8 SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosa... 26 7.8 >SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1822 Score = 25.8 bits (54), Expect = 7.8 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 527 ISETVVPIDVIDLTINDKNVPVANGHL*EHSYGPMSR 637 + ET VP DVI+ + KNV + + + H G SR Sbjct: 1087 VDETEVP-DVINARVRRKNVNIGSSNSIRHVSGSTSR 1122 >SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 941 Score = 25.8 bits (54), Expect = 7.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 585 TFLSFIVKSMTSIGTTVSLIXSVRLIQSHQCFQFPLKVSLEK 460 +F+ + K + G T+ + RL SH Q P++VSL + Sbjct: 300 SFIKYCTKLEVTAGCTLISYIADRLQNSHPNIQPPIRVSLNE 341 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,765,166 Number of Sequences: 5004 Number of extensions: 44961 Number of successful extensions: 108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 422462090 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -