BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30174.Seq (853 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0561 + 4122751-4123140,4124226-4124484,4124639-4124985 30 2.0 01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 28 8.2 >01_01_0561 + 4122751-4123140,4124226-4124484,4124639-4124985 Length = 331 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/94 (23%), Positives = 38/94 (40%) Frame = +3 Query: 255 NAVIQKADVYDSDSNHSLIESNKSKTSYVVTEKSLPNADVYESDSSHSENVKEKPAKINX 434 +AV+ + + SN + E+N K T A S +N K K AK + Sbjct: 195 DAVLAELGISGGSSNAAQDENNAEKKGSNQTGDGDAPAPSESKSSKKKKNKKAKEAKESQ 254 Query: 435 XXXXXXXXXXXEKPLEETENIDVTESIARRXSVR 536 +P E+T ++DV E + + S++ Sbjct: 255 EPADGTEETASAEPDEDTTSVDVKERLKKMASMK 288 >01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 Length = 492 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 692 DMPWXGNATSP*SSETLSPVTLAHNY 615 ++P G AT P SS+ S VTL+H Y Sbjct: 56 ELPACGAATIPSSSDGTSSVTLSHRY 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,597,975 Number of Sequences: 37544 Number of extensions: 278597 Number of successful extensions: 471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2373961368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -