BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30173.Seq (898 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 4e-25 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 5e-24 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 107 9e-24 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 107 1e-23 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 106 2e-23 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 106 2e-23 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 106 2e-23 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 106 2e-23 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 106 2e-23 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 106 2e-23 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 2e-23 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 3e-23 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 105 4e-23 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 105 4e-23 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 105 4e-23 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 105 4e-23 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 105 4e-23 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 4e-23 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 8e-23 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 104 8e-23 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 8e-23 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 1e-22 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 104 1e-22 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 103 1e-22 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 103 3e-22 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 103 3e-22 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 103 3e-22 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 102 3e-22 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 102 3e-22 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 102 3e-22 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 102 3e-22 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 102 3e-22 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 102 3e-22 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 102 3e-22 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 102 3e-22 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 102 3e-22 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 102 3e-22 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 102 3e-22 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 102 3e-22 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 102 3e-22 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 102 3e-22 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 102 3e-22 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 102 3e-22 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 102 3e-22 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 102 3e-22 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 102 3e-22 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 102 3e-22 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 102 3e-22 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 102 3e-22 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 102 3e-22 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 102 3e-22 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 102 3e-22 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 102 3e-22 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 102 3e-22 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 102 3e-22 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 102 3e-22 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 102 3e-22 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 102 3e-22 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 102 3e-22 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 102 3e-22 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 102 3e-22 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 102 3e-22 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 102 3e-22 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 102 3e-22 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 102 3e-22 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 102 5e-22 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 102 5e-22 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 102 5e-22 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 102 5e-22 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 102 5e-22 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 102 5e-22 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 102 5e-22 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 102 5e-22 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 102 5e-22 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 102 5e-22 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 102 5e-22 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 102 5e-22 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 102 5e-22 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 102 5e-22 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 102 5e-22 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 102 5e-22 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 102 5e-22 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 102 5e-22 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 102 5e-22 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 102 5e-22 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 102 5e-22 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 102 5e-22 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 102 5e-22 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 102 5e-22 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 102 5e-22 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 102 5e-22 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 102 5e-22 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 102 5e-22 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 102 5e-22 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 102 5e-22 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 102 5e-22 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 102 5e-22 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 102 5e-22 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 102 5e-22 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 102 5e-22 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 102 5e-22 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 102 5e-22 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 102 5e-22 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 102 5e-22 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 102 5e-22 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 102 5e-22 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 102 5e-22 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 102 5e-22 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 102 5e-22 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 102 5e-22 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 102 5e-22 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 102 5e-22 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 102 5e-22 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 102 5e-22 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 102 5e-22 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 102 5e-22 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 102 5e-22 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 102 5e-22 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 102 5e-22 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 102 5e-22 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 102 5e-22 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 102 5e-22 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 112 bits (269), Expect = 4e-25 Identities = 53/70 (75%), Positives = 57/70 (81%) Frame = -3 Query: 266 NKNLREF*QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 87 NKN + F N + + + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS Sbjct: 201 NKNSKRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 260 Query: 86 RRCKTTASEL 57 RRCKTTASEL Sbjct: 261 RRCKTTASEL 270 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 109 bits (262), Expect = 3e-24 Identities = 52/61 (85%), Positives = 55/61 (90%) Frame = -3 Query: 239 NINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 60 N+ A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 59 L 57 L Sbjct: 498 L 498 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 108 bits (260), Expect = 5e-24 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = -3 Query: 242 QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 ++++ + P+ + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 577 Query: 62 E 60 E Sbjct: 578 E 578 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 107 bits (258), Expect = 9e-24 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = -3 Query: 236 INAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 + A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 107 bits (257), Expect = 1e-23 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = -3 Query: 206 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 107 bits (257), Expect = 1e-23 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -3 Query: 209 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 369 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 285 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 25 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 259 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 278 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 128 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 579 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 106 bits (255), Expect = 2e-23 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 493 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 106 bits (254), Expect = 3e-23 Identities = 50/56 (89%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = -3 Query: 221 LPFAIQX-RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 +P A+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 226 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 359 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 105 bits (253), Expect = 4e-23 Identities = 52/63 (82%), Positives = 54/63 (85%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*Y 51 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPG 59 Query: 50 DSL 42 D L Sbjct: 60 DPL 62 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 130 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 269 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 253 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 120 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 195 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 105 bits (253), Expect = 4e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 392 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 104 bits (250), Expect = 8e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +2 Query: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 202 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 108 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 104 bits (250), Expect = 8e-23 Identities = 51/58 (87%), Positives = 51/58 (87%), Gaps = 3/58 (5%) Frame = +2 Query: 47 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP---NSCAXEW 211 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP S EW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 104 bits (250), Expect = 8e-23 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +2 Query: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 202 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 103 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 104 bits (249), Expect = 1e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 P A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 104 bits (249), Expect = 1e-22 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -3 Query: 224 NLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 66 +L ++I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 509 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 103 bits (248), Expect = 1e-22 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -3 Query: 227 YNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 103 bits (248), Expect = 1e-22 Identities = 48/55 (87%), Positives = 51/55 (92%), Gaps = 2/55 (3%) Frame = -3 Query: 221 LPFA--IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 +PF ++ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 103 bits (248), Expect = 1e-22 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -3 Query: 227 YNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 103 bits (248), Expect = 1e-22 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = -3 Query: 206 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 164 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 211 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 103 bits (246), Expect = 3e-22 Identities = 51/62 (82%), Positives = 54/62 (87%) Frame = -3 Query: 242 QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 +N A + PF + RNC EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 39 KNQGASHSPFRL--RNCGEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 96 Query: 62 EL 57 EL Sbjct: 97 EL 98 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 103 bits (246), Expect = 3e-22 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = -3 Query: 230 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 103 bits (246), Expect = 3e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 209 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 ++ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 103 bits (246), Expect = 3e-22 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 209 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 I RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) Length = 1160 Score = 103 bits (246), Expect = 3e-22 Identities = 48/59 (81%), Positives = 51/59 (86%) Frame = -3 Query: 239 NINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 N ++ L + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 842 NASSSQLVNSSSLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 900 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 474 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 67 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 648 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 557 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 102 bits (245), Expect = 3e-22 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -3 Query: 209 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 I RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 190 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 916 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 102 bits (245), Expect = 3e-22 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -3 Query: 212 AIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 444 AHRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 493 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 264 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 202 CATVGKGDRCGPLRYYASWRKGDVLQGD 119 CATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 91 CATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 70 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 102 bits (245), Expect = 3e-22 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -3 Query: 218 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 148 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 261 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 426 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 152 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 63 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 148 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 385 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 125 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 179 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 188 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 878 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 225 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 301 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 369 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 146 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 56 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 64 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 441 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 164 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 459 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 206 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 97 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -3 Query: 200 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 63 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 230 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 96 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 177 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 102 bits (244), Expect = 5e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 64 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 201 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,576,570 Number of Sequences: 59808 Number of extensions: 546761 Number of successful extensions: 5103 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5095 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2574115416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -