BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30173.Seq (898 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024826-14|AAF60791.1| 332|Caenorhabditis elegans Mrna decappi... 32 0.64 >AC024826-14|AAF60791.1| 332|Caenorhabditis elegans Mrna decapping enzyme protein 1 protein. Length = 332 Score = 31.9 bits (69), Expect = 0.64 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 101 LALPNLIALQHIPLSPAGVIAKRP-APIALPNSCAXEWRMANCKR*YFVKIRVN 259 LA NL LQ I ++ + ++ K P A I ++ EW +NC+ +FV R + Sbjct: 12 LAAKNLAQLQKIDIAASKILDKMPFAAIYHIDAARKEWNQSNCEGTFFVYQRAD 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,421,922 Number of Sequences: 27780 Number of extensions: 395459 Number of successful extensions: 816 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2276333906 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -