BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30168.Seq (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26F1.10c |pyp1||tyrosine phosphatase Pyp1|Schizosaccharomyce... 26 5.8 SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit S... 26 7.7 >SPAC26F1.10c |pyp1||tyrosine phosphatase Pyp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 550 Score = 26.2 bits (55), Expect = 5.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 420 NCSELHIKRSV*CLLSILNLSFVGIENFHF 509 NC+ +H+KR+ L +N SF+ E ++ Sbjct: 308 NCTRVHLKRTSPSELDYINASFIKTETSNY 337 >SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit Spo6|Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 25.8 bits (54), Expect = 7.7 Identities = 15/61 (24%), Positives = 32/61 (52%) Frame = -2 Query: 654 PAHQFNKSQMSALHNQLQNHMILHLIA*CVQKSKIHYIIMSNSLPLCKKSGNSQFPQNSN 475 PAH+ K +S + QN+++ + + V++ Y I +++ K+ ++FP+ N Sbjct: 312 PAHEIRKQLLSCTNQTNQNNVVKNSASVLVRQIMGDYNITESAVDGAKQM-PTEFPKPEN 370 Query: 474 L 472 L Sbjct: 371 L 371 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,213,030 Number of Sequences: 5004 Number of extensions: 63041 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -