BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30167.Seq (898 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 7.5 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 9.9 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.8 bits (44), Expect = 7.5 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -1 Query: 727 FKXXTNLPXXXGHFFTIKNXTXLXKVTAIKLSLNKKFV 614 +K L G FFT+ N T + L L +FV Sbjct: 159 YKYYQILSHLSGIFFTVFNVAQCYLTTELVLMLQTRFV 196 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 119 LLALFCRIFLKHICYY 72 L A +C+ K +CYY Sbjct: 15 LFAAYCKAESKVVCYY 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,604 Number of Sequences: 336 Number of extensions: 3173 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -