BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30167.Seq (898 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1314 - 25721137-25721538 53 3e-07 10_01_0053 - 767131-767962,768517-769037,769384-769601,769720-76... 29 5.0 09_04_0683 - 19431034-19431495,19431632-19431997,19432055-194323... 29 6.6 >07_03_1314 - 25721137-25721538 Length = 133 Score = 53.2 bits (122), Expect = 3e-07 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 8/104 (7%) Frame = +2 Query: 254 LTGYPLAINATDIKVKEVDFNPEFISRVIPKLDWEVLWVAADSIGHSDGLPR-------- 409 +TGYPL + KE + NPEF+ ++PK+DW L A ++G + LP Sbjct: 17 VTGYPLKLQVVKWSTKEAEPNPEFLRGMLPKIDWPALVAATQALGLPELLPEAPPTDAEL 76 Query: 410 SLENKYDENEEFLKKAHKXXXXXXXXXGHLTCPNLXDNFRFLKG 541 S E + L++ H+ G L CP+ F +G Sbjct: 77 SAEGAAADEGSALRRLHRALLEIHIEEGALVCPDTDRCFPISRG 120 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 517 RQFPISKGIPNMXLNEAEVQ 576 R FPIS+G+PNM L+E EV+ Sbjct: 113 RCFPISRGVPNMLLHEDEVR 132 >10_01_0053 - 767131-767962,768517-769037,769384-769601,769720-769825, 769958-770017 Length = 578 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 325 KFRIKIDFFNFNVCRVNCKRIASQTPFKHFEVSILWVISFIIIFVLCNF 179 + R K FFN+ +N + + T + ++ W ISF+I+ V+ F Sbjct: 190 ELRRKGSFFNWYTFMINSGSLLASTVLVWLQDNVGWGISFVIVVVVMAF 238 >09_04_0683 - 19431034-19431495,19431632-19431997,19432055-19432326, 19433621-19433686,19433924-19433978,19434509-19434577, 19435200-19435307,19435394-19435462,19435883-19436038, 19436089-19436229,19436514-19436568,19437103-19437233, 19437382-19437486 Length = 684 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 353 WEVLWVAADSIGHSDGLP 406 W++ WVA +IGHS+ LP Sbjct: 576 WQLWWVALRAIGHSECLP 593 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,576,661 Number of Sequences: 37544 Number of extensions: 291157 Number of successful extensions: 603 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -