BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30167.Seq (898 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 2.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 5.0 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 8.7 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 8.7 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 22 8.7 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 2.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 271 KRIASQTPFKHFEVSILWVISFIIIF 194 K ++ ++HF I W+ FI+IF Sbjct: 393 KSRTKESAWRHFAAIIEWLSFFIVIF 418 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 5.0 Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Frame = +2 Query: 197 YNNETNYPQYAHFEMLERCLTGYPLAINATDIKVKEVDFNPEFISRVIPKLDW---EVLW 367 Y+N +PQ F L Y INA ++++ + + I K+D E L Sbjct: 303 YSNGVTFPQRNRFSSLPYYKYKYLNVINALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLN 362 Query: 368 VAADSI-GHSDGLPRSLENKYD 430 + + I G+SD + YD Sbjct: 363 MLGNVIEGNSDSINTKFYGMYD 384 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 8.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 230 HFEMLERCLTGYPLAINATDIKVKEV 307 H E L L G + N +I VKE+ Sbjct: 295 HHEALTEALPGDNVGFNVKNISVKEL 320 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 8.7 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +2 Query: 197 YNNETNYPQYAHFEMLERCLTGYPLAINATDIKVKEVDFNPEFISRVIPKLD 352 Y+N +PQ F L Y INA ++++ + + I K+D Sbjct: 303 YSNGVTFPQRNRFSSLPYYKYKYLNVINALEMRLMDAIDSGYLIDEYGKKID 354 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 21.8 bits (44), Expect = 8.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 230 HFEMLERCLTGYPLAINATDIKVKEV 307 H E L L G + N +I VKE+ Sbjct: 6 HHEALTEALPGDNVGFNVKNISVKEL 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,042 Number of Sequences: 438 Number of extensions: 4111 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29025360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -