BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30165.Seq (897 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B8.02 |php5||CCAAT-binding factor complex subunit Php5|Schi... 86 7e-18 SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosa... 42 9e-05 SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|... 27 3.6 SPCPJ732.03 |meu15||sequence orphan|Schizosaccharomyces pombe|ch... 26 8.4 SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomy... 26 8.4 >SPBC3B8.02 |php5||CCAAT-binding factor complex subunit Php5|Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 85.8 bits (203), Expect = 7e-18 Identities = 42/77 (54%), Positives = 57/77 (74%), Gaps = 2/77 (2%) Frame = +1 Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVK--MISAEAPVLFAKAA 459 AQ L ++W K ++ ++ + + KT LPLARIKK+MK D++VK MISAEAP LFAK + Sbjct: 83 AQALAEYWQKTIDTLEH-DDQAVKTLHLPLARIKKVMKTDDDVKNKMISAEAPFLFAKGS 141 Query: 460 EIFIHELTLRAWSHTEE 510 EIFI ELT+RAW H ++ Sbjct: 142 EIFIAELTMRAWLHAKK 158 >SPAC17G8.03c |dpb3||DNA polymerase epsilon subunit Dpb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 199 Score = 42.3 bits (95), Expect = 9e-05 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +1 Query: 334 KVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHT 504 K N + P+ARIKKIM+ D++V ++ PV+ +KA E+F+ + + T Sbjct: 13 KPNPATYWKSRFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQT 69 >SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1402 Score = 27.1 bits (57), Expect = 3.6 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 189 WTFCSFFNQLHETNAPMFLFNYHSKLILKLCFGKL 85 WTF F+ Q++ +LF+Y ++ L F L Sbjct: 1080 WTFTLFWYQIYNNFDANYLFDYTYVMLFNLIFSSL 1114 >SPCPJ732.03 |meu15||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 150 Score = 25.8 bits (54), Expect = 8.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 340 NSEDFKTQALPLARIKKIMKL 402 N ++ K Q LPL IKKI K+ Sbjct: 16 NLQEVKPQVLPLEEIKKIYKI 36 >SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 349 Score = 25.8 bits (54), Expect = 8.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 625 LRRRXESPQHGSVLPPV 675 LR R +SP+H S +PP+ Sbjct: 59 LRMRMQSPKHASYIPPL 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,125,780 Number of Sequences: 5004 Number of extensions: 56622 Number of successful extensions: 147 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -