BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30163.Seq (824 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 25 0.64 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 4.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 4.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.9 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 25.4 bits (53), Expect = 0.64 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 334 DGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420 DG+ V VA E GF+ G P P+ Sbjct: 81 DGQQVSITYVADENGFQVQGSHIPTAPPI 109 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +1 Query: 220 QRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAV 348 +R+EW++ H+ E HQ +K V S+ +A+ Sbjct: 726 RRKEWLYLHRARSESEFEMYHQQLQGVAKNKKNVGSMSRNKAL 768 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 4.5 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -1 Query: 794 PCCWFEXC 771 PCCW++ C Sbjct: 487 PCCWWKIC 494 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 4.5 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -1 Query: 794 PCCWFEXC 771 PCCW++ C Sbjct: 540 PCCWWKIC 547 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.9 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +1 Query: 529 DVVDPRPTKGVHKEMRVKKEALYHLSAFFPSQFSRWTPW 645 DVV+ +P K K + H + FF + + PW Sbjct: 438 DVVELQPVKSSKSSGWRKLRNIVHWTPFFQTYKKQRYPW 476 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,092 Number of Sequences: 438 Number of extensions: 2834 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -