BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30160.Seq (904 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 4.2 AY748837-1|AAV28185.1| 97|Anopheles gambiae cytochrome P450 pr... 24 5.5 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 7.3 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 4.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 291 RCLHAVGSGGTPGWPCDPKNTI 356 +CLH + +G + GW +NT+ Sbjct: 16 KCLHPLRTGRSQGWYMHGRNTL 37 >AY748837-1|AAV28185.1| 97|Anopheles gambiae cytochrome P450 protein. Length = 97 Score = 24.2 bits (50), Expect = 5.5 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -2 Query: 498 AYVRPAILRDERSLIPDVERSTSCPTNYCRRIHCRSLR 385 A + + R+ + ++PD + +YCR + +LR Sbjct: 10 ATAQDRLYREAKKILPDPRENRIAEASYCRAVLKETLR 47 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.8 bits (49), Expect = 7.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +3 Query: 24 QVLKYKVK*NEMKMTNLKN*VINWDETKWNGMRWTHNVRDTILD 155 Q K KVK E K L ++N DE K R + + +LD Sbjct: 667 QQTKMKVKRQEQKCKELTARLVNVDEEKVKFERSCRTIIEQLLD 710 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 888,307 Number of Sequences: 2352 Number of extensions: 16866 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -