BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30160.Seq (904 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 64 1e-12 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 24 2.2 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 5.0 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 8.8 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 64.5 bits (150), Expect = 1e-12 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +3 Query: 501 IVGITNPQGKKRYIAAAFPSACGKTNLAMMTPNTGPGTK 617 I+ ITNP+GKKRYI AAFPSACGKTNLAMM P T PG K Sbjct: 1 ILAITNPKGKKRYITAAFPSACGKTNLAMMKP-TLPGYK 38 Score = 37.9 bits (84), Expect = 1e-04 Identities = 21/46 (45%), Positives = 25/46 (54%) Frame = +2 Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSCXQVXSXGN 742 PGYK+ CVGDDIA MKF + R + + GFFG S N Sbjct: 35 PGYKIECVGDDIAWMKF-DKEGRLRA-INPEYGFFGVAPGTSSATN 78 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 23.8 bits (49), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELR 250 G+ +PE R R E+ ARL EF E R Sbjct: 13 GKNGSPEEKRPRTAFSAEQLARLKREFAENR 43 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 5.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELR 250 G PE R R E+ ARL EF E R Sbjct: 13 GNGGTPEEKRPRTAFSGEQLARLKREFAENR 43 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 8.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 123 WTHNVRDTIL 152 WTHNV D +L Sbjct: 163 WTHNVLDMVL 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,492 Number of Sequences: 438 Number of extensions: 5078 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -