BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30159.Seq (712 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces... 28 1.1 SPBC660.17c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 6.1 >SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 204 VQYQFVEVINKTLKSDLNTKLELFTMYVFNLFFYLSLVVILIM 76 + QF+ I ++ + KL Y+ LF ++S++VIL M Sbjct: 192 IAIQFIHFILASMPTKYIAKLNSVGTYLNTLFLFISMIVILAM 234 >SPBC660.17c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 172 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 609 ITLFRCTYVYYFYXIRSGVF 550 ++LF C YV YF + G+F Sbjct: 77 LSLFYCAYVMYFLPLEVGLF 96 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,345,531 Number of Sequences: 5004 Number of extensions: 41305 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -