BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30156.Seq (961 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 27 0.64 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 7.9 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 27.5 bits (58), Expect = 0.64 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 396 QQRSYWFGCEVQQGSRHCHSRRYYPC*AVSSNQSEEV 506 ++R+YW+ E+ Q HC R A SS Q E++ Sbjct: 268 RRRAYWWTTEIAQCRSHCIEARRKMNRAKSSEQREDL 304 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.8 bits (49), Expect = 7.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 347 VCFCTGMILRTSSFRDGPRKKSMISNSLIGKKTSK 243 VC + RTSSF P +++ +IG +T++ Sbjct: 76 VCCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTE 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 855,043 Number of Sequences: 2352 Number of extensions: 16564 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 105430005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -