BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30155.Seq (883 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 100 4e-20 UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 100 4e-20 UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 100 4e-20 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 100 4e-20 UniRef50_Q8GEF9 Cluster: Putative uncharacterized protein; n=1; ... 91 5e-17 UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. ... 73 1e-11 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 70 9e-11 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 66 8e-10 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 54 5e-06 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 53 1e-05 UniRef50_P62593 Cluster: Beta-lactamase TEM precursor; n=261; ro... 48 2e-04 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 44 0.004 UniRef50_Q1UYY9 Cluster: Putative uncharacterized protein; n=1; ... 41 0.036 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 41 0.048 UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria... 40 0.11 UniRef50_Q9R4I2 Cluster: Beta-lactamase; n=5; Gammaproteobacteri... 36 1.0 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 1.4 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 36 1.8 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 34 4.2 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 34 5.5 UniRef50_Q5CYC7 Cluster: Uncharacterized protein with predicted ... 33 7.3 UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j... 33 9.6 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 100 bits (240), Expect = 4e-20 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 100 bits (240), Expect = 4e-20 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 100 bits (240), Expect = 4e-20 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 27 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 71 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 100 bits (240), Expect = 4e-20 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 9 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53 >UniRef50_Q8GEF9 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 99 Score = 90.6 bits (215), Expect = 5e-17 Identities = 44/78 (56%), Positives = 46/78 (58%) Frame = +3 Query: 606 VRWHFSGKCARNPYLFIFLNTFKYVXRS*DNNPDKCFNNIEKGRV*VFNISVAPYSLFAA 785 VRWHFSGKCARNPYLFIFLNTFKYV ++K PYSLF Sbjct: 22 VRWHFSGKCARNPYLFIFLNTFKYVSAHETITLINASIILKKEEYEYSTFPCRPYSLFCG 81 Query: 786 FXLSCFCSPRKRGESKRC 839 SCFCSPR GESKRC Sbjct: 82 ILPSCFCSPRNAGESKRC 99 >UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. SS|Rep: LacZ alpha peptide - Beggiatoa sp. SS Length = 73 Score = 72.9 bits (171), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 495 LATFAGFPRQALNRGLPLGFRFSALRHLDPKKL 397 LATFAGFPRQALNRGLPLGFRFSALRHLDPKKL Sbjct: 40 LATFAGFPRQALNRGLPLGFRFSALRHLDPKKL 72 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 2 DAPCSGALSAAGVVVTRSVTAT 23 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 69.7 bits (163), Expect = 9e-11 Identities = 37/53 (69%), Positives = 42/53 (79%), Gaps = 2/53 (3%) Frame = +2 Query: 2 PSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNS--CAXEWRMA 154 PSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ A P+ + +WRMA Sbjct: 7 PSFYNVVTGKTLALPNLIALQHIPLSPAGVISEE-ARTDRPSQQLRSLKWRMA 58 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 66.5 bits (155), Expect = 8e-10 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 7 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 129 +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q Sbjct: 18 ILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQ 58 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 54.0 bits (124), Expect = 5e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +1 Query: 7 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 VL R DW N +T LNRL AHP FASWR+ AR + PS + R Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRR 59 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 52.8 bits (121), Expect = 1e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 123 A +L R DW+NP +T +NRL +H P WR+++ AR PS Sbjct: 19 ATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPS 59 >UniRef50_P62593 Cluster: Beta-lactamase TEM precursor; n=261; root|Rep: Beta-lactamase TEM precursor - Escherichia coli Length = 286 Score = 48.4 bits (110), Expect = 2e-04 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +1 Query: 766 LIPFLRHFXFPVFAHPENVVKVKDAEDSFG 855 LIPF F PVFAHPE +VKVKDAED G Sbjct: 10 LIPFFAAFCLPVFAHPETLVKVKDAEDQLG 39 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 44.4 bits (100), Expect = 0.004 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +1 Query: 7 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 129 ++ RRDWENP Q+N++ AH P ++ E+AR + SQ+ Sbjct: 7 IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK 47 >UniRef50_Q1UYY9 Cluster: Putative uncharacterized protein; n=1; Candidatus Pelagibacter ubique HTCC1002|Rep: Putative uncharacterized protein - Candidatus Pelagibacter ubique HTCC1002 Length = 26 Score = 41.1 bits (92), Expect = 0.036 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 847 NLQHLLLSPRFLGEQKQEXQNAAKRE 770 +LQHLLLSP FLGEQKQE + KRE Sbjct: 1 DLQHLLLSPAFLGEQKQEGKMPQKRE 26 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 40.7 bits (91), Expect = 0.048 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 85 WRNSEEARTDRPSQQLR 135 WRNSEEARTDRPSQQLR Sbjct: 47 WRNSEEARTDRPSQQLR 63 >UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp. PE36 Length = 45 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 156 FAIRHSXAQLLGRAIGAGLFAITPAGERG 70 FAI+ AQLLGRAIGAGLFAITP E G Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPEFELG 38 >UniRef50_Q9R4I2 Cluster: Beta-lactamase; n=5; Gammaproteobacteria|Rep: Beta-lactamase - Shigella flexneri Length = 52 Score = 36.3 bits (80), Expect = 1.0 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 799 VFAHPENVVKVKDAEDSFG 855 VFAHPE +VKVKDAED G Sbjct: 1 VFAHPETLVKVKDAEDQLG 19 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 7 VLQRRDWENPGVTQLNRLAAHPP 75 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 35.5 bits (78), Expect = 1.8 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 19 RDWENPGVTQLNRLAAHPPFASWRNSEEA 105 R+WEN +TQ+NR H P+ ++ + E+A Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQA 31 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 34.3 bits (75), Expect = 4.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 7 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 114 +L +DW+NP + + + H P S+R +EAR D Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLD 42 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 33.9 bits (74), Expect = 5.5 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 16 RRDWENPGVTQLNRLAAHPPFASWRNSEEART 111 + DWENP V Q+NRL A S+ E+A T Sbjct: 31 KNDWENPDVIQINRLPARATSYSFDTPEQALT 62 >UniRef50_Q5CYC7 Cluster: Uncharacterized protein with predicted coiled coil regions; n=2; Cryptosporidium|Rep: Uncharacterized protein with predicted coiled coil regions - Cryptosporidium parvum Iowa II Length = 825 Score = 33.5 bits (73), Expect = 7.3 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 244 SLINKRI--DRDRVECCSSLEQESTIKERGLQRQRAKNRL 357 SL N+ I +RD V C S+ Q+S IKER L+ ++ K +L Sbjct: 119 SLSNQNIKSERDNVSKCLSIRQQSLIKERELRLEKTKLKL 158 >UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09076 protein - Schistosoma japonicum (Blood fluke) Length = 109 Score = 33.1 bits (72), Expect = 9.6 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 126 A L+RR+ +NPG QLN L A P F +++A +R S+ Sbjct: 57 AAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSK 98 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 859,694,380 Number of Sequences: 1657284 Number of extensions: 17257151 Number of successful extensions: 39772 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 38451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39763 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 79112361923 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -