BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30155.Seq (883 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 102 3e-22 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 1e-21 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 101 1e-21 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 100 1e-21 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 100 1e-21 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 100 1e-21 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 100 1e-21 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 100 1e-21 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 100 1e-21 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 100 1e-21 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 100 1e-21 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 100 1e-21 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 100 1e-21 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 100 1e-21 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 100 1e-21 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 100 1e-21 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 100 1e-21 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 100 1e-21 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 100 1e-21 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 100 1e-21 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 100 1e-21 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 100 1e-21 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 100 1e-21 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 100 1e-21 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 100 1e-21 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 100 1e-21 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 100 1e-21 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 100 1e-21 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 100 1e-21 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 100 1e-21 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 100 1e-21 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 100 1e-21 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 100 1e-21 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 100 1e-21 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 100 1e-21 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 100 1e-21 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 100 1e-21 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 100 1e-21 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 100 1e-21 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 100 1e-21 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 100 1e-21 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 100 1e-21 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 100 1e-21 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 100 1e-21 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 100 1e-21 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 100 1e-21 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 100 1e-21 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 100 1e-21 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 100 1e-21 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 100 1e-21 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 100 1e-21 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 100 1e-21 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 100 1e-21 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 100 1e-21 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 100 1e-21 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 100 1e-21 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 100 1e-21 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 100 1e-21 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 100 1e-21 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 100 1e-21 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 100 1e-21 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 100 1e-21 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 100 1e-21 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 100 1e-21 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 100 1e-21 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 100 1e-21 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 100 1e-21 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 100 1e-21 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 100 1e-21 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 100 1e-21 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 100 1e-21 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 100 1e-21 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 100 1e-21 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 100 1e-21 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 100 1e-21 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_24066| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 100 1e-21 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 100 1e-21 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 100 1e-21 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 100 1e-21 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 100 1e-21 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 100 1e-21 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 100 1e-21 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 100 1e-21 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 100 1e-21 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 103 bits (247), Expect = 2e-22 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 176 QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3 ++++ + P+ + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 575 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 102 bits (245), Expect = 3e-22 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = -3 Query: 173 NINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3 N+ A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 494 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 102 bits (245), Expect = 3e-22 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 158 NLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3 +L ++I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 508 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 101 bits (241), Expect = 1e-21 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -3 Query: 152 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3 P A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 101 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 101 bits (241), Expect = 1e-21 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = -3 Query: 170 INAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3 + A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 228 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 87 DAPCSGALSAAGVVVTRSVTAT 108 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 96 DAPCSGALSAAGVVVTRSVTAT 117 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 114 DAPCSGALSAAGVVVTRSVTAT 135 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 119 DAPCSGALSAAGVVVTRSVTAT 140 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 90 DAPCSGALSAAGVVVTRSVTAT 111 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 110 DAPCSGALSAAGVVVTRSVTAT 131 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 71 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 122 DAPCSGALSAAGVVVTRSVTAT 143 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 98 DAPCSGALSAAGVVVTRSVTAT 119 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 87 DAPCSGALSAAGVVVTRSVTAT 108 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 111 DAPCSGALSAAGVVVTRSVTAT 132 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 105 DAPCSGALSAAGVVVTRSVTAT 126 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 70 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 121 DAPCSGALSAAGVVVTRSVTAT 142 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 92 DAPCSGALSAAGVVVTRSVTAT 113 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 217 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 261 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 268 DAPCSGALSAAGVVVTRSVTAT 289 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 112 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 163 DAPCSGALSAAGVVVTRSVTAT 184 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 17 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 48 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 99 DAPCSGALSAAGVVVTRSVTAT 120 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 382 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 426 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 433 DAPCSGALSAAGVVVTRSVTAT 454 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 108 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 152 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 159 DAPCSGALSAAGVVVTRSVTAT 180 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 84 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 135 DAPCSGALSAAGVVVTRSVTAT 156 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 91 DAPCSGALSAAGVVVTRSVTAT 112 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 9 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 60 DAPCSGALSAAGVVVTRSVTAT 81 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 19 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 63 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 90 DAPCSGALSAAGVVVTRSVTAT 111 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 104 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 148 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 155 DAPCSGALSAAGVVVTRSVTAT 176 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 97 DAPCSGALSAAGVVVTRSVTAT 118 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 341 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 385 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 392 DAPCSGALSAAGVVVTRSVTAT 413 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 81 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 125 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 132 DAPCSGALSAAGVVVTRSVTAT 153 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 17 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 111 DAPCSGALSAAGVVVTRSVTAT 132 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 179 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 186 DAPCSGALSAAGVVVTRSVTAT 207 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 64 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 115 DAPCSGALSAAGVVVTRSVTAT 136 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 91 DAPCSGALSAAGVVVTRSVTAT 112 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 144 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 188 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 195 DAPCSGALSAAGVVVTRSVTAT 216 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 834 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 878 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 17 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 112 DAPCSGALSAAGVVVTRSVTAT 133 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 86 DAPCSGALSAAGVVVTRSVTAT 107 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 74 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 125 DAPCSGALSAAGVVVTRSVTAT 146 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 108 DAPCSGALSAAGVVVTRSVTAT 129 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 70 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 121 DAPCSGALSAAGVVVTRSVTAT 142 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 257 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 301 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 308 DAPCSGALSAAGVVVTRSVTAT 329 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 115 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 89 DAPCSGALSAAGVVVTRSVTAT 110 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 102 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 146 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 153 DAPCSGALSAAGVVVTRSVTAT 174 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 115 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 166 DAPCSGALSAAGVVVTRSVTAT 187 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 21 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 110 DAPCSGALSAAGVVVTRSVTAT 131 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 89 DAPCSGALSAAGVVVTRSVTAT 110 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 86 DAPCSGALSAAGVVVTRSVTAT 107 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 12 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 56 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 20 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 64 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 397 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 441 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 448 DAPCSGALSAAGVVVTRSVTAT 469 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 97 DAPCSGALSAAGVVVTRSVTAT 118 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 106 DAPCSGALSAAGVVVTRSVTAT 127 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 120 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 164 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 171 DAPCSGALSAAGVVVTRSVTAT 192 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 107 DAPCSGALSAAGVVVTRSVTAT 128 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 117 DAPCSGALSAAGVVVTRSVTAT 138 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 120 DAPCSGALSAAGVVVTRSVTAT 141 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 415 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 459 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 466 DAPCSGALSAAGVVVTRSVTAT 487 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 112 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 119 DAPCSGALSAAGVVVTRSVTAT 140 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 108 DAPCSGALSAAGVVVTRSVTAT 129 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 98 DAPCSGALSAAGVVVTRSVTAT 119 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 162 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 206 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 213 DAPCSGALSAAGVVVTRSVTAT 234 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 117 DAPCSGALSAAGVVVTRSVTAT 138 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 97 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 104 DAPCSGALSAAGVVVTRSVTAT 125 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 89 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 64 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 115 DAPCSGALSAAGVVVTRSVTAT 136 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 186 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 230 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 237 DAPCSGALSAAGVVVTRSVTAT 258 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 86 DAPCSGALSAAGVVVTRSVTAT 107 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 92 DAPCSGALSAAGVVVTRSVTAT 113 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 106 DAPCSGALSAAGVVVTRSVTAT 127 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 103 DAPCSGALSAAGVVVTRSVTAT 124 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 86 DAPCSGALSAAGVVVTRSVTAT 107 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 87 DAPCSGALSAAGVVVTRSVTAT 108 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 101 DAPCSGALSAAGVVVTRSVTAT 122 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 91 DAPCSGALSAAGVVVTRSVTAT 112 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 133 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 177 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 93 DAPCSGALSAAGVVVTRSVTAT 114 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 136 DAPCSGALSAAGVVVTRSVTAT 157 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 154 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 198 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 341 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 385 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 392 DAPCSGALSAAGVVVTRSVTAT 413 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 110 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 154 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 161 DAPCSGALSAAGVVVTRSVTAT 182 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 87 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 131 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 138 DAPCSGALSAAGVVVTRSVTAT 159 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 295 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 339 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 346 DAPCSGALSAAGVVVTRSVTAT 367 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 110 DAPCSGALSAAGVVVTRSVTAT 131 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 17 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 412 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 456 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 463 DAPCSGALSAAGVVVTRSVTAT 484 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 96 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 140 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 147 DAPCSGALSAAGVVVTRSVTAT 168 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 103 DAPCSGALSAAGVVVTRSVTAT 124 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 100 bits (240), Expect = 1e-21 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -3 Query: 140 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 933 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 94 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 145 DAPCSGALSAAGVVVTRSVTAT 166 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 212 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 256 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 263 DAPCSGALSAAGVVVTRSVTAT 284 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 214 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 258 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 78 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 90 DAPCSGALSAAGVVVTRSVTAT 111 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 148 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 192 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 199 DAPCSGALSAAGVVVTRSVTAT 220 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 97 DAPCSGALSAAGVVVTRSVTAT 118 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 87 DAPCSGALSAAGVVVTRSVTAT 108 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 107 DAPCSGALSAAGVVVTRSVTAT 128 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 196 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 240 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 247 DAPCSGALSAAGVVVTRSVTAT 268 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 105 DAPCSGALSAAGVVVTRSVTAT 126 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 33 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 77 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 84 DAPCSGALSAAGVVVTRSVTAT 105 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 87 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 131 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 138 DAPCSGALSAAGVVVTRSVTAT 159 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 23 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 101 DAPCSGALSAAGVVVTRSVTAT 122 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 188 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 232 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 239 DAPCSGALSAAGVVVTRSVTAT 260 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 119 DAPCSGALSAAGVVVTRSVTAT 140 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 101 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 145 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 77 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 121 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 128 DAPCSGALSAAGVVVTRSVTAT 149 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 97 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 148 DAPCSGALSAAGVVVTRSVTAT 169 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 74 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 101 DAPCSGALSAAGVVVTRSVTAT 122 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 664 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 708 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 715 DAPCSGALSAAGVVVTRSVTAT 736 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 49 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 100 DAPCSGALSAAGVVVTRSVTAT 121 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 89 DAPCSGALSAAGVVVTRSVTAT 110 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 147 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 191 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 90 DAPCSGALSAAGVVVTRSVTAT 111 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 89 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 101 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 145 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 1191 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 1235 Score = 69.7 bits (163), Expect = 3e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 164 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSW 45 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 402 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 94 DAPCSGALSAAGVVVTRSVTAT 115 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 33 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 77 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 126 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 170 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 108 DAPCSGALSAAGVVVTRSVTAT 129 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 78 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 122 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 127 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 171 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 178 DAPCSGALSAAGVVVTRSVTAT 199 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 169 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 213 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 220 DAPCSGALSAAGVVVTRSVTAT 241 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 32 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 76 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 81 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 125 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 132 DAPCSGALSAAGVVVTRSVTAT 153 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 31 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 75 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCS ALSAAGVVV VTAT Sbjct: 82 DAPCSAALSAAGVVVTRSVTAT 103 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 97 DAPCSGALSAAGVVVTRSVTAT 118 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 17 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 127 DAPCSGALSAAGVVVTRSVTAT 148 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 926 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 970 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 977 DAPCSGALSAAGVVVTRSVTAT 998 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 98 DAPCSGALSAAGVVVTRSVTAT 119 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 88 DAPCSGALSAAGVVVTRSVTAT 109 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 97 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 141 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 354 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 398 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 405 DAPCSGALSAAGVVVTRSVTAT 426 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 84 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 135 DAPCSGALSAAGVVVTRSVTAT 156 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 117 DAPCSGALSAAGVVVTRSVTAT 138 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 127 DAPCSGALSAAGVVVTRSVTAT 148 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 9 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 60 DAPCSGALSAAGVVVTRSVTAT 81 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 106 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 81 DAPCSGALSAAGVVVTRSVTAT 102 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 41 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 127 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 171 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 178 DAPCSGALSAAGVVVTRSVTAT 199 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 1474 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 1518 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 1525 DAPCSGALSAAGVVVTRSVTAT 1546 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 98 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 149 DAPCSGALSAAGVVVTRSVTAT 170 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 106 DAPCSGALSAAGVVVTRSVTAT 127 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 105 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 149 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 156 DAPCSGALSAAGVVVTRSVTAT 177 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 48 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 99 DAPCSGALSAAGVVVTRSVTAT 120 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 909 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 953 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 960 DAPCSGALSAAGVVVTRSVTAT 981 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 91 DAPCSGALSAAGVVVTRSVTAT 112 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 44 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 95 DAPCSGALSAAGVVVTRSVTAT 116 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 42 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 93 DAPCSGALSAAGVVVTRSVTAT 114 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 69 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 109 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 153 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 82 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 608 DAPCSGALSAAGVVVY 561 DAPCSGALSAAG V+ Sbjct: 133 DAPCSGALSAAGSNVH 148 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 100 bits (240), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +1 Query: 1 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 90 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 134 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 608 DAPCSGALSAAGVVVYAHVTAT 543 DAPCSGALSAAGVVV VTAT Sbjct: 141 DAPCSGALSAAGVVVTRSVTAT 162 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,523,718 Number of Sequences: 59808 Number of extensions: 544585 Number of successful extensions: 8464 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8458 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -