BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30155.Seq (883 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U12966-4|AAA20616.1| 365|Caenorhabditis elegans Carbonic anhydr... 30 2.5 AC199172-11|ABO33270.1| 311|Caenorhabditis elegans F-box a prot... 29 5.8 >U12966-4|AAA20616.1| 365|Caenorhabditis elegans Carbonic anhydrase protein 1 protein. Length = 365 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 697 ITLINASIILKKEEYEYSTF-PWRLIPFLR 783 +T+ ASI K + + + F PWRL+PF R Sbjct: 256 LTIATASISYKDQRVQLADFEPWRLLPFTR 285 >AC199172-11|ABO33270.1| 311|Caenorhabditis elegans F-box a protein protein 50, isoforma protein. Length = 311 Score = 28.7 bits (61), Expect = 5.8 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +1 Query: 616 TFRGNVRGTPICLFF*IHSNMYXAHETITLINASIILKKEEYEYSTFPWRLIPFLRHFXF 795 T R ++ G I FF S + I +I ++ + STF W +I FLR Sbjct: 203 TIRYSIFGAKIAHFFHFKSFYIYTLDKFKAIQTAIQIRDDLLRRSTFQWCVIRFLRPNAN 262 Query: 796 PV 801 P+ Sbjct: 263 PI 264 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,533,873 Number of Sequences: 27780 Number of extensions: 406014 Number of successful extensions: 911 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -