BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30153.Seq (864 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 26 1.7 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 24 6.9 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 9.1 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.8 bits (54), Expect = 1.7 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 108 NSTSADSA-LKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRID 245 +S+ DS L GE R+L+ + + QR+ KR+D PDR + Sbjct: 998 SSSVLDSMDLINGERASIARLLEEHEPEAEPQRKATKRSDSGPDRTE 1044 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 23.8 bits (49), Expect = 6.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 370 SECRINENTKFPSLNTTSYQEP 435 S+C+ N+KFP L S +EP Sbjct: 234 SQCKTGRNSKFPGLCNAS-EEP 254 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 9.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 281 ATHSPSSGLGHPVDPI 234 AT +PS G+G P+ P+ Sbjct: 450 ATLTPSPGIGGPISPL 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 894,278 Number of Sequences: 2352 Number of extensions: 18397 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92199573 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -