BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30152.Seq (877 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.03c |tas3||RITS complex subunit 3 |Schizosaccharomyces po... 29 1.1 SPAC23D3.08 |usp108||U1 snRNP-associated protein Usp108|Schizosa... 26 8.1 >SPBC83.03c |tas3||RITS complex subunit 3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 549 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -3 Query: 692 PVASEGIRRSVL-RLLQSNAINTFVHPLRVCNRKHALQKS*FQDSFLGSMNF*D-DRNKA 519 P+ ++G + V + L+ N++ F P+ KH ++ F D GSM D + + Sbjct: 122 PLVTDGKEKPVKSKQLRKNSVTEFEKPIETKKSKHRKSRNKFLDKSSGSMEIESWDNSTS 181 Query: 518 EALQES 501 +++ ES Sbjct: 182 DSIIES 187 >SPAC23D3.08 |usp108||U1 snRNP-associated protein Usp108|Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 25.8 bits (54), Expect = 8.1 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 771 LGQLTIPDGPIGSTPVKINWAAFELGDCSTTQIFP 875 + + P+ P G P+ + A TTQ+FP Sbjct: 214 MSSMVTPENPYGIPPIALTSAGGNPDPLRTTQVFP 248 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,482,237 Number of Sequences: 5004 Number of extensions: 70325 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -