BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30151.Seq (892 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0316 + 3479574-3482679,3482766-3483127 31 1.2 12_01_0220 - 1657554-1657620,1657943-1658109,1658110-1658267,165... 30 2.8 11_01_0219 - 1710206-1710246,1710479-1710620,1710699-1710752,171... 30 2.8 10_06_0080 + 10441055-10443856 28 8.7 >10_01_0316 + 3479574-3482679,3482766-3483127 Length = 1155 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 Query: 808 PNPGDXXPLIDTTLNRRSLTQMVAGQIGPEQRREPLFFYTNPSDGSCESVL 656 P G L+D L++ SLT + +IG R + L+ Y N G L Sbjct: 377 PEIGKCRQLVDLQLHKNSLTGTIPPEIGELSRLQKLYLYNNLLHGPVPQAL 427 >12_01_0220 - 1657554-1657620,1657943-1658109,1658110-1658267, 1658362-1658447,1658559-1658808,1659194-1660320, 1662207-1662351,1663555-1663696,1663775-1663828, 1663914-1663985,1664710-1664778,1664885-1664926, 1665024-1665092,1665257-1665394,1665518-1665628, 1665704-1665836,1666834-1666889,1667191-1667901 Length = 1198 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 254 LVPAKNPHAPPPVSVKTTGPVWDIGQVLKAARLLCKP 364 LVP +P PPP+S GP +D Q+ LL +P Sbjct: 51 LVPF-SPAQPPPLSNLLAGPAFDAEQIWSQIELLSRP 86 >11_01_0219 - 1710206-1710246,1710479-1710620,1710699-1710752, 1710838-1710909,1711631-1711699,1711807-1711848, 1711946-1712014,1712130-1712267,1712390-1712500, 1712576-1712726,1713720-1713775,1714076-1714753 Length = 540 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 254 LVPAKNPHAPPPVSVKTTGPVWDIGQVLKAARLLCKP 364 LVP +P PPP+S GP +D Q+ LL +P Sbjct: 51 LVPF-SPAQPPPLSNLLAGPAFDAEQIWSQIELLSRP 86 >10_06_0080 + 10441055-10443856 Length = 933 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/53 (26%), Positives = 31/53 (58%) Frame = -1 Query: 526 IAKLCDVAGVLWVVSQELNIVHGLVQDTFISENVINNRINETHFLFVLEIDLL 368 + +L ++ G + + +EL ++H F+S + NR N+T+ ++V E+ +L Sbjct: 33 VTQLTELQGSMGRIKRELRLMH-----EFLSRMDVRNRNNQTYEIWVEEVRML 80 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,584,227 Number of Sequences: 37544 Number of extensions: 444975 Number of successful extensions: 1066 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -