BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30151.Seq (892 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07) 30 2.2 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_15001| Best HMM Match : Calx-beta (HMM E-Value=0.023) 29 5.1 SB_36184| Best HMM Match : UBA (HMM E-Value=2.4e-09) 28 8.8 >SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07) Length = 246 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +2 Query: 362 PPQQVDFED-EQEMRFVYSVIYDVFR 436 PP +VDF++ E+ R VYSVIY V R Sbjct: 5 PPVKVDFKERERTKRIVYSVIYGVGR 30 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 380 FEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLADY 490 F+D+ E R YS+ + RY+ VL+ + D F + + Sbjct: 109 FDDDLERRRAYSMAFGAKRYELVLEDVLLDSYFFSSF 145 >SB_15001| Best HMM Match : Calx-beta (HMM E-Value=0.023) Length = 308 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 387 TNKKCVSFILLFMTFSDINVSWTRPWTILSSWLTTHSTPATSHSL 521 T + +F+L FS I+ + T+++SW ST TSH L Sbjct: 251 TQGRPYNFLLCRYEFSAISFDVAKSVTVVASWTFVSSTMLTSHCL 295 >SB_36184| Best HMM Match : UBA (HMM E-Value=2.4e-09) Length = 1337 Score = 28.3 bits (60), Expect = 8.8 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +3 Query: 402 VSFILLFMTFSDINVSWTRPWTILSSWLTTHS-TPATSHSLAIPXGVSETSLGGQTKGRA 578 V+ +L+ M ++ SWT + LT+ + + ATS + + G S T +G +++ + Sbjct: 681 VTTVLINMINQTLS-SWTEDLYGRADSLTSPAPSAATSSTTLVAAGSSSTLVGSRSRDDS 739 Query: 579 RTRYTTIGKGAGQP 620 +R ++ G G P Sbjct: 740 FSRSVSVESGGGSP 753 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,627,993 Number of Sequences: 59808 Number of extensions: 495242 Number of successful extensions: 1143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -