BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30150.Seq (821 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64300.1 68414.m07287 protein kinase family protein contains ... 29 3.7 >At1g64300.1 68414.m07287 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 717 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 590 HNYWXALDNHLREMENVVXEQRVHFRSCPS 679 H W AL+ LRE+ V E ++ R+C S Sbjct: 59 HTKWRALEQPLRELYRVFKEGEMYVRNCMS 88 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,557,198 Number of Sequences: 28952 Number of extensions: 253109 Number of successful extensions: 543 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1882599200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -