BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30147.Seq (878 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 26 0.45 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.7 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 9.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 9.7 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 25.8 bits (54), Expect = 0.45 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 466 LGVKQLIVGVNKMDSLNHHTVSPDL-RKSRRKYPHTSRRLGYNPAAVAFVPISGWHGD 636 LG+K L + ++ ++L + ++P L RKS KY + VPISG H D Sbjct: 344 LGMKYLDMVIS--ETLRKYPLAPFLNRKSDVKYTFEETGFTLDKGVSIMVPISGLHYD 399 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 Query: 303 GNIVLASFELPESNIDLIP 247 GNI + + +P NI+ +P Sbjct: 151 GNIAMELWNMPRENIEPLP 169 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 571 MYEDTSFLISSNLGSLYGGSVNPFCLLL 488 ++ D S ++ LG Y G + +CLL+ Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 571 MYEDTSFLISSNLGSLYGGSVNPFCLLL 488 ++ D S ++ LG Y G + +CLL+ Sbjct: 262 LWVDLSHMMQQ-LGKAYSGMYSMYCLLI 288 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,631 Number of Sequences: 336 Number of extensions: 4518 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24306755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -