BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30142.Seq (600 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q758T8 Cluster: SWR1-complex protein 3; n=1; Eremotheci... 32 9.0 >UniRef50_Q758T8 Cluster: SWR1-complex protein 3; n=1; Eremothecium gossypii|Rep: SWR1-complex protein 3 - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 688 Score = 32.3 bits (70), Expect = 9.0 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 112 YIILYTLTRNFFEF*QFKKKILM*VGTLKTKERKREREIQ-CIFN*LNKPKWP 267 Y++ + + N E QFK K+L G K K + E E+Q C+FN P P Sbjct: 551 YLMSWIVVHNKKEIEQFKLKVLK--GLNKNKPNEEETEVQPCLFNVYEHPNCP 601 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,989,825 Number of Sequences: 1657284 Number of extensions: 6973155 Number of successful extensions: 11331 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11329 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42317807226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -