BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30142.Seq (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex ... 26 3.7 >SPAC24H6.06 |sld3|mug175|DNA replication pre-initiation complex subunit Sld3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 668 Score = 26.2 bits (55), Expect = 3.7 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = +1 Query: 169 KILM*VGTLKTKERKREREIQCIFN*LNKPKWPLLKFINHRNCSLCKYVYIYYFNKRNSE 348 ++L + LK+ + ++ R +QC + LN W L+F N + K ++ N N E Sbjct: 260 ELLKFLDNLKSVDDRKSRLLQCFESHLNYKAWH-LEFENEAHQYEIKGYRLWLQNILNRE 318 Query: 349 DC 354 +C Sbjct: 319 NC 320 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,799,442 Number of Sequences: 5004 Number of extensions: 31784 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -