BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30141.Seq (897 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 26 1.8 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 3.1 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 4.1 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 7.2 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 7.2 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 7.2 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 7.2 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 9.5 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 9.5 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 25.8 bits (54), Expect = 1.8 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -3 Query: 577 LNREGQNLDSHSSDVRRSHFAYQPANWSLSLYTSST 470 LNR+ QN+++ +++ + A Q + W+ Y T Sbjct: 128 LNRDFQNMENFKKEMKAAAVAVQGSGWAWLGYNKKT 163 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.0 bits (52), Expect = 3.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 52 VIVLVVKCSVCIVKVTVKGFKMG 120 V+++ CS+C + TVK + G Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTG 157 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 4.1 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 522 WLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653 +L + + W S FC + R +TT+ W + + A+ + +AE Sbjct: 1052 FLMGSQDNWSS-FCEAARRITTTLQRDWDTEREQRAASNREEAE 1094 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 7.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 176 PKQPPETISASLGPTVWMLPILNPFTVT 93 P QPPET++ + + + P + P T T Sbjct: 1471 PVQPPETLTPAGSVAITVEPSVPPATTT 1498 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 9.5 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = +2 Query: 716 NGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFW 844 N R I + + ++ ++ ++ R + L+ ERAFW Sbjct: 290 NWRSYIHVAESEKNREEHAQVLDKIWLKEREIEQELEAERAFW 332 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 9.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90 H T + V PK T + ++ PT P P TF Sbjct: 112 HTITRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,010,904 Number of Sequences: 2352 Number of extensions: 23449 Number of successful extensions: 51 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -