BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30139.Seq (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 48 5e-06 SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23) 48 7e-06 SB_8088| Best HMM Match : UCH (HMM E-Value=1.1e-20) 46 2e-05 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_21866| Best HMM Match : UCH (HMM E-Value=0) 46 4e-05 SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10) 43 2e-04 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 41 8e-04 SB_29469| Best HMM Match : UCH (HMM E-Value=6.7e-06) 38 0.010 SB_47787| Best HMM Match : DUF1556 (HMM E-Value=3.4) 37 0.018 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) 36 0.031 SB_8927| Best HMM Match : UCH (HMM E-Value=0) 35 0.055 SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_40551| Best HMM Match : Extensin_2 (HMM E-Value=0.076) 32 0.51 SB_52114| Best HMM Match : Galactosyl_T (HMM E-Value=3.5e-25) 30 1.6 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 30 1.6 SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_24189| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.8 SB_93| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) 28 8.3 >SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476 +LQD L F + + L+GDN Y C +C K R VK I LP VL + LKRF ++ Sbjct: 151 NLQDSLEQFVNGEILEGDNAYFCEKCNKRRTTVKRMCIKTLPPVLVIQLKRFGYD 205 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/55 (40%), Positives = 30/55 (54%) Frame = +3 Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473 + LQDCL F +EL ++++ CS C R K + P L VHLKR+RH Sbjct: 1000 LQLQDCLRTFVDREEL--EDLWPCSMCNAQRTATKSLSVCRFPDTLIVHLKRYRH 1052 >SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23) Length = 422 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/56 (37%), Positives = 33/56 (58%) Frame = +3 Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473 VV L DC+ F + ++L ++ + C +CKK + K + LP VL +HLKRF + Sbjct: 245 VVQLNDCIQLFLTREKLGANDPWYCPQCKKHQQASKKFDLWCLPEVLVIHLKRFSY 300 >SB_8088| Best HMM Match : UCH (HMM E-Value=1.1e-20) Length = 379 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE-LLFS 488 +L++C+ F + L D+ + C +CKK R K + LP L +HLKRF + +LF Sbjct: 255 TLRECVELFTEPETLGEDDAWHCPKCKKHREATKQMSLWRLPDTLIIHLKRFSFKNILFR 314 Query: 489 AKV 497 K+ Sbjct: 315 DKI 317 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +1 Query: 67 SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195 SII D+F G+L S + C +C +S + + F +LS+P+P L Sbjct: 69 SIIVDMFQGQLKSKLTCPVCKTISIKYDPFMNLSVPLPKENKL 111 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +3 Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479 P +SL++ L FF + L+G N Y C RC+ L++ + I P L + LKRF + + Sbjct: 712 PSISLEEMLGYFFEPEMLEGSNQYHCERCQGLQDAERSVVIANAPMFLVLTLKRFSYNV 770 Score = 37.1 bits (82), Expect = 0.014 Identities = 23/60 (38%), Positives = 31/60 (51%) Frame = +1 Query: 19 RAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLA 198 R+ SG+ G G ++ +II D F G+L+ C C VS R E F DL L P + A Sbjct: 581 RSMSGA-GLGQDM-ISNIIEDTFSGRLIVCHSCRRCRHVSCREEAFTDLPLAFPHQRDAA 638 >SB_21866| Best HMM Match : UCH (HMM E-Value=0) Length = 2165 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/55 (40%), Positives = 30/55 (54%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476 SL D + F D L+G N Y C +C K + VK I LP V+ + LKRF ++ Sbjct: 1452 SLHDSMEQFVKGDLLEGANAYHCEKCDKKVDTVKRMCISKLPRVMAIQLKRFDYD 1506 >SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10) Length = 1303 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = +1 Query: 64 RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180 +SII D+F G+L S V+C+ C VS R + F LSLP+P Sbjct: 496 QSIIVDLFQGQLKSQVRCVECGYVSARFDPFTFLSLPLP 534 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 348 DELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494 D L GDNMY+CS+C K K + VLP +LC + R+ ++ K Sbjct: 1288 DTLDGDNMYTCSQCGKKVRAEKRACFTVLPRILCFNTMRYTFNMVTMMK 1336 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 41.1 bits (92), Expect = 8e-04 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 67 SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177 +I+ ++F G+L+ +CL C+ R E FQD+S+P+ Sbjct: 118 NIVEEMFQGRLVHETKCLTCENAKQRFEDFQDVSVPV 154 Score = 34.7 bits (76), Expect = 0.072 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467 +L+ ++ F + + LK +N Y C C + +LP VL +HLKRF Sbjct: 183 TLEWAISQFATVEVLKDNNKYFCENCCTYTEARLSTFFDLLPQVLTLHLKRF 234 >SB_29469| Best HMM Match : UCH (HMM E-Value=6.7e-06) Length = 757 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467 SL C+ F ++L DN Y C++C+ ++ + + LP VL + L RF Sbjct: 136 SLNQCIKEFLKEEKLDCDNQYFCTQCQSKQDARRYIELKHLPPVLNLQLLRF 187 >SB_47787| Best HMM Match : DUF1556 (HMM E-Value=3.4) Length = 382 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +1 Query: 76 SDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180 SD+F G L S + CL C S + F DLSLPIP Sbjct: 347 SDLFVGVLKSTLICLECGFKSVTFDPFWDLSLPIP 381 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 35.9 bits (79), Expect = 0.031 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +1 Query: 67 SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186 S + D+F + SA+ C C + ST + F LSLPIP R Sbjct: 2096 SFVLDLFQAQYRSALSCPKCKQKSTTFDPFLCLSLPIPQR 2135 >SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) Length = 969 Score = 35.9 bits (79), Expect = 0.031 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNG 407 S+ CL+ F + + L G N ++C C K RNG Sbjct: 701 SVMSCLSVFCAKETLTGKNKFACEECTKARNG 732 >SB_8927| Best HMM Match : UCH (HMM E-Value=0) Length = 316 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/46 (30%), Positives = 29/46 (63%) Frame = +1 Query: 73 ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210 + ++F G L + +CL C+ VS++ E+F DLS+ + ++ ++ C Sbjct: 205 VHEMFEGTLTNETRCLCCESVSSKDESFLDLSVDV--EQNTSITHC 248 >SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKK 395 +LQD L F + + L+GDN Y C +C K Sbjct: 159 NLQDSLEQFVNGEILEGDNAYFCEKCNK 186 >SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 32.3 bits (70), Expect = 0.39 Identities = 22/58 (37%), Positives = 29/58 (50%) Frame = +3 Query: 57 EVPKHHIRRVRXEVTISRSVPNM*QGINENRNIPRLVAADPVPGTLGRAALPAAHAEP 230 EVPK H RR T+SRS P +GI+E + ++A +PV G A A P Sbjct: 22 EVPKSHRRRP----TVSRSRPKPDEGISEAVEVDIVIAGEPVTVDGGVAKTREAKPSP 75 >SB_40551| Best HMM Match : Extensin_2 (HMM E-Value=0.076) Length = 1269 Score = 31.9 bits (69), Expect = 0.51 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 162 LVAADPVPGTLGRAALPAAHAEPPRGPQRTG 254 +V DP+P T AA PA +A PP GP + G Sbjct: 709 MVHYDPMPQTSNPAARPAFYAVPPGGPVQFG 739 >SB_52114| Best HMM Match : Galactosyl_T (HMM E-Value=3.5e-25) Length = 383 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +1 Query: 49 SNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ--PM 222 S +K+R++ + G +L+ + CL + VSTRI+ + + L P R RC Q + Sbjct: 6 STLKHRNLPDENAVGLVLNKLLCL--NTVSTRIKRYHNFPLIGPIRLRQGCQRCSQMSSI 63 Query: 223 LNHHAA 240 ++H A+ Sbjct: 64 VSHDAS 69 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 629 CPAAYRAHVADHRXQRVPRXGTRCTLC 549 CP AY H A +RVPR C +C Sbjct: 1745 CPLAYHVHCAYPPLRRVPRGNWACQVC 1771 >SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +3 Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467 V ++D L +EL+G ++CS+ + + VLP VL +HLKRF Sbjct: 524 VSCIEDALNHLTVKEELQG---FTCSKTNAQIDVSRRVSFEVLPKVLILHLKRF 574 >SB_24189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +1 Query: 100 LSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195 +S ++C D VSTR+E F D+ L + ++++ Sbjct: 355 VSYIKCTKVDYVSTRLEPFYDIQLNVKGKKNI 386 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 7/32 (21%) Frame = +3 Query: 321 DCLAAFFSADELK-------GDNMYSCSRCKK 395 DC AAFF+A ELK G+ Y+C C K Sbjct: 614 DCDAAFFAAHELKKHSRRHTGEKPYACVNCNK 645 >SB_93| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = +1 Query: 316 CKTVWPP-SSAPTNSKAT 366 C TVWPP +S+PTN AT Sbjct: 2 CATVWPPTTSSPTNYTAT 19 >SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1283 Score = 27.9 bits (59), Expect = 8.3 Identities = 22/72 (30%), Positives = 27/72 (37%) Frame = +3 Query: 9 EFGTSKKRFIRRRQQREVPKHHIRRVRXEVTISRSVPNM*QGINENRNIPRLVAADPVPG 188 E S+KR R KH + V + V Q EN N V A P Sbjct: 999 EHSPSRKR--RNSDNHGHKKHSLTGVSLPSVVEVKVKPASQSAEENENDVTEVRASPSKC 1056 Query: 189 TLGRAALPAAHA 224 T+GR + AHA Sbjct: 1057 TMGRQSKLVAHA 1068 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,667,580 Number of Sequences: 59808 Number of extensions: 344967 Number of successful extensions: 1068 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -